TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01335 XX ID T01335 XX DT 25.10.1994 (created); ewi. DT 21.04.2009 (updated); ach. CO Copyright (C), QIAGEN. XX FA NR1B1-isoform1 XX SY NR1B1; RAR-alpha1; retinoic acid receptor alpha1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G000591 Rara. XX CL C0002; CC (rec); 2.1.2.1.1.1. XX SZ 462 AA; 50.7 kDa (cDNA) (calc.). XX SQ MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPAT SQ IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM SQ VYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTL SQ TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV SQ EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA SQ GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALK SQ VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL SQ DTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP XX SC Swiss-Prot#P11416-1 XX FT 85 156 SM00399; c4gold. FT 85 160 PS51030; NUCLEAR_REC_DBD_2. FT 86 161 PF00105; Zinc finger, C4 type (two domains). FT 230 388 SM00430; holi. FT 233 413 PF00104; Ligand-binding domain of nuclear hormon. XX SF modulating transactivation functions within A/B region; SF AF-2 within C-terminal region; XX FF AF-2 is ligand-inducible and promoter context-dependent; FF modulating function is also promoter context-dependent, but ligand-independent; XX IN T01366 RXR-beta2; mouse, Mus musculus. XX MX M00965 V$DR4_Q2. MX M07280 V$NR1NR2_Q3. MX M02787 V$RARA_03. MX M02891 V$RARA_04. MX M00963 V$T3R_Q6. XX DR TRANSPATH: MO000025594. DR EMBL: X56572; DR UniProtKB: P11416-1; XX RN [1]; RE0000270. RX PUBMED: 1326406. RA Nagpal S., Saunders M., Kastner P., Durand B., Nakshatri H., Chambon P. RT Promoter context-and response element-dependent specificity of the transcriptional activation and modulating functions of retinoic acid receptors RL Cell 70:1007-1019 (1992). RN [2]; RE0047728. RX PUBMED: 8887632. RA L'Horset F., Dauvois S., Heery D. M., Cavailles V., Parker M. G. RT RIP-140 interacts with multiple nuclear receptors by means of two distinct sites. RL Mol. Cell. Biol. 16:6029-6036 (1996). XX //