TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09116 XX ID T09116 XX DT 20.07.2006 (created); spi. DT 08.05.2013 (updated); vad. CO Copyright (C), QIAGEN. XX FA securin XX SY EAP1; ESP1-associated protein 1; HPTTG; pituitary tumor-transforming 1; pituitary tumor-transforming protein 1; PTTG; PTTG1; securin; tumor transforming protein 1; TUTR1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G013651 PTTG1; HGNC: PTTG1. XX SZ 202 AA; 22.0 kDa (calc.). XX SQ MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKAT SQ RKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPF SQ NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQ SQ SPSSILSTLDVELPPVCCDIDI XX SC translated from EMBL #AF095287 XX FT 1 191 PF04856; Securin sister-chromatid separation inhibito. XX IN T18732 aebp2; human, Homo sapiens. IN T15300 HMG17; human, Homo sapiens. IN T18664 NOLA2; human, Homo sapiens. IN T10643 TBPL1; human, Homo sapiens. XX DR TRANSPATH: MO000083564. DR EMBL: AF095287; DR UniProtKB: O95997; PTTG1_HUMAN. XX RN [1]; RE0025241. RX PUBMED: 12355087. RA Bernal J. A., Luna R., Espina A., Lazaro I., Ramos-Morales F., Romero F., Arias C., Silva A., Tortolero M., Pintor-Toro J. A. RT Human securin interacts with p53 and modulates p53-mediated transcriptional activity and apoptosis. RL Nat. Genet. 32:306-311 (2002). RN [2]; RE0031397. RX PUBMED: 12956947. RA Vodermaier H. C., Gieffers C., Maurer-Stroh S., Eisenhaber F., Peters J. M. RT TPR subunits of the anaphase-promoting complex mediate binding to the activator protein CDH1. RL Curr. Biol. 13:1459-68 (2003). RN [3]; RE0035154. RX PUBMED: 15016801. RA Kho P. S., Wang Z., Zhuang L., Li Y., Chew J. L., Ng H. H., Liu E. T., Yu Q. RT p53-regulated transcriptional program associated with genotoxic stress-induced apoptosis. RL J. Biol. Chem. 279:21183-21192 (2004). RN [4]; RE0038099. RX PUBMED: 12194817. RA Waizenegger I., Gimenez-Abian J., Wernic D., Peters J. RT Regulation of human separase by securin binding and autocleavage RL Curr. Biol. 12:1368 (2002). RN [5]; RE0039232. RX PUBMED: 11179223. RA Zur A., Brandeis M. RT Securin degradation is mediated by fzy and fzr, and is required for complete chromatid separation but not for cytokinesis RL EMBO J. 20:792-801 (2001). RN [6]; RE0048865. RX PUBMED: 16868023. RA Holland A. J., Taylor S. S. RT Cyclin-B1-mediated inhibition of excess separase is required for timely chromosome disjunction. RL J. Cell Sci. 119:3325-3336 (2006). XX //