TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09174 XX ID T09174 XX DT 02.08.2006 (created); jul. DT 02.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Pit-1-isoform1 XX SY GHF-1; growth hormone factor 1; Pit-1; Pit-1B; pituitary-specific positive transcription factor 1; POU1F1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004568 Pou1f1. XX CL C0007; POU; 3.1.10.1.1.2. XX SZ 291 AA; 32.9 kDa (cDNA) (calc.). XX SQ MSCQSFTSADTFITLNSDASAALPLRMHHSAAECLPASNHATNVMSTATGLHYSVPSCHY SQ GNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPLHQPLLAEDPAASEFKQELRRKSKLVEE SQ PIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF SQ KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISVAAKDALERHFGEHSKPS SQ SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR XX SC Swiss-Prot#Q00286-1 XX FT 124 198 PF00157; Pou domain - N-terminal to homeobox domain. FT 124 198 SM00352; pou. FT 212 272 PS50071; HOMEOBOX_2. FT 212 274 PS50550; POU_HOMEODOMAIN. FT 214 276 SM00389; HOX_1. FT 215 271 PF00046; Homeobox domain. XX IN T33673 Ets-1; chick, Gallus gallus. XX MX M01465 V$PIT1_01. MX M00802 V$PIT1_Q6. MX M03559 V$PIT1_Q6_01. MX M00744 V$POU1F1_Q6. XX DR TRANSPATH: MO000084116. DR EMBL: D12885; MMPIT1R. DR EMBL: D12886; MMPIT1D. DR UniProtKB: Q00286-1; XX RN [1]; RE0002474. RX PUBMED: 1901656. RA Steinfelder H. J., Hauser P., Nakayama Y., Radovick S., McClaskey J. H., Taylor T., Weintraub B. D., Wondisford F. E. RT Thyrotropin-releasing hormone regulation of human TSHB expression: Role of a pituitary-specific transcription factor (Pit-1/GHF-1) and potential interaction with a thyroid hormone-inhibitory element RL Proc. Natl. Acad. Sci. USA 88:3130-3134 (1991). RN [2]; RE0004422. RX PUBMED: 1977085. RA Li S., Crenshaw III E. B., Rawson E. J., Simmons D. M., Swanson L. W., Rosenfeld M. G. RT Dwarf locus mutants lacking three pituitary cell types result from mutations in the POU-domain gene pit-1 RL Nature 347:528-533 (1990). RN [3]; RE0004423. RX PUBMED: 8166682. RA Jehn B., Chicaiza G., Martin F., Jaggi R. RT Isolation of three novel POU-domain containing cDNA clones from lactating mouse mammary gland RL Biochem. Biophys. Res. Commun. 200:156-162 (1994). RN [4]; RE0004425. RX PUBMED: 1690079. RA Dolle P., Castrillo J.-L., Theill L. E., Deerinck T., Ellisman M., Karin M. RT Expression of GHF-1 protein in mouse pituitaries correlates both temporally and spatially with the onset of growth hormone gene activity RL Cell 60:809-820 (1990). RN [5]; RE0004426. RX PUBMED: 1981057. RA Camper S. A., Saunders T. L., Katz R. W., Reeves R. H. RT The Pit-1 transcription factor gene is a candidate for the murine Snell dwarf mutation RL Genomics 8:586-590 (1990). RN [6]; RE0004429. RX PUBMED: 1677216. RA Castrillo J.-L., Theill L. E., Karin M. RT Function of the homeodomain protein GHF1 in pituitary cell proliferation RL Science 253:197-199 (1991). RN [7]; RE0004437. RX PUBMED: 1310694. RA Steinfelder H. J., Radovick S., Mroczynski M. A., Hauser P., McClaskey J. H., Weintraub B. D., Wondisford F. E. RT Role of a pituitary-specific transcription factor (Pit-1/GHF-1) or a closely related protein in cAMP regulation of human thyrotropin-b subunit gene expression RL J. Clin. Invest. 89:409-419 (1992). RN [8]; RE0017919. RX PUBMED: 10652292. RA Bradford A. P., Brodsky K. S., Diamond S. E., Kuhn L. C., Liu Y., Gutierrez-Hartmann A. RT The Pit-1 homeodomain and beta-domain interact with Ets-1 and modulate synergistic activation of the rat prolactin promoter. RL J. Biol. Chem. 275:3100-3106 (2000). XX //