TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09225 XX ID T09225 XX DT 16.08.2006 (created); din. DT 24.04.2008 (updated); grs. CO Copyright (C), QIAGEN. XX FA En-1 XX SY Engrailed 1; Gg-en.1 (chick); Hu-en.1 (human); Mo-en.1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006023 En1. XX CL C0006; homeo. XX SZ 401 AA; 40.9 kDa (cDNA) (calc.). XX SQ MEEQQPEPKSQRDSGLGAVAAAAPSGLSLSLSPGASGSSGSDGDSVPVSPQPAPPSPPAA SQ PCLPPLAHHPHLPPHPPPPPPPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFG SQ CKKEQPLPQLLVASAAAGGGAAAGGGSRVERDRGQTGAGRDPVHSLGTRASGAASLLCAP SQ DANCGPPDGSQPATAVGAGASKAGNPAAAAAAAAAAAAAAVAAAAAAASKPSDSGGGSGG SQ NAGSPGAQGAKFPEHNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRT SQ RKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWF SQ QNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE XX SC Swiss-Prot#P09065 XX FT 25 362 PF00478; IMP dehydrogenase / GMP reductase domain. FT 310 370 PS50071; HOMEOBOX_2. FT 312 374 SM00389; HOX_1. FT 313 369 PF00046; Homeobox domain. XX IN T09446 c-Jun; Mammalia. XX MX M00396 V$EN1_01. MX M01365 V$EN1_02. XX BS R09094. BS R09095. BS R09096. BS R09097. BS R09098. BS R09099. BS R09100. BS R09101. BS R09102. BS R09103. XX DR TRANSPATH: MO000085063. DR EMBL: L12702; DR EMBL: L12703; DR UniProtKB: P09065; XX RN [1]; RE0003871. RX PUBMED: 8096059. RA Catron K. M., Iller N., Abate C. RT Nucleotides flanking a conserved TAAT core dictate the DNA binding specifity of three murine homeodomain proteins RL Mol. Cell. Biol. 13:2354-2365 (1993). RN [2]; RE0005044. RX PUBMED: 2892757. RA Joyner A. L., Martin G. R. RT En-1 and En-2, two mouse genes with sequence homology to the Drosophila engrailed gene: expression during embryogenesis RL Genes Dev. 1:29-38 (1987). RN [3]; RE0005045. RX PUBMED: 1363401. RA Logan C., Hanks M. C., Noble-Topham S., Nallainathan D., Provart N. J., Joyner A. L. RT Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions RL Dev. Genet. 13:345-358 (1992). RN [4]; RE0005046. RX PUBMED: 2416459. RA Joyner L. A., Kornberg T., Coleman K. G., Cox D. R., Martin G. R. RT Expression during embryogenesis of a mouse gene with sequence homology to the Drosophila engrailed gene RL Cell 43:29-37 (1985). RN [5]; RE0005047. RX PUBMED: 1980115. RA Holland P. W. H., Williams N. A. RT Conservation of engrailed-like homeobox sequences during vertebrate evolution RL FEBS Lett. 277:250-252 (1990). RN [6]; RE0005048. RX PUBMED: 7624797. RA Hanks M., Wurst W., Anson-Cartwright L., Auerbach A. B., Joyner A. L. RT Rescue of the En-1 mutant phenotype by replacement of En-1 with En-2 RL Science 269:679-682 (1995). RN [7]; RE0005050. RX PUBMED: 1534034. RA McMahon A. P., Joyner A. L., Bradley A., McMahon J. A. RT The midbrain-hindbrain phenotype of Wnt-1-/Wnt-1- mice results from stepwise deletion of engrailed-expressing cells by 9.5 days postcoitum RL Cell 69:581-595 (1992). RN [8]; RE0005498. RX PUBMED: 7925010. RA Wurst W., Auerbach A. B., Joyner A. L. RT Multiple developmental defects in Engrailed-1 mutant mice: an early mid-hindbrain deletion and patterning defects in forelimbs and sternum RL Development 120:2065-2075 (1994). RN [9]; RE0015359. RA Frohman M. A., Dickinson M. E., Hogan B. L. M., Martin G. R. RT Mapping of Gbx-1 to mouse chromosome 5 and Gbx-2 to mouse chromosome 1 RL Mouse Genome 91:323-325 (1993). RN [10]; RE0052694. RX PUBMED: 11551904. RA Schaefer L. K., Wang S., Schaefer T. S. RT Functional interaction of Jun and homeodomain proteins. RL J. Biol. Chem. 276:43074-43082 (2001). XX //