TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10010 XX ID T10010 XX DT 13.12.2006 (created); kau. DT 13.12.2006 (updated); kau. CO Copyright (C), QIAGEN. XX FA MyoD XX SY MyoD; XMyoD. XX OS clawed frog, Xenopus laevis OC eukaryota; animalia; metazoa; chordata; vertebrata; amphibia; lissamphibia; anura; archeobatrachia; pipoidea; pipidae XX GE G001913 MyoD. XX CL C0010; bHLH. XX SZ 289 AA; 32.3 kDa (cDNA) (calc.). XX SQ MELLPPPLRDMEVTEGSLCAFPTPDDFYDDPCFNTSDMSFFEDLDPRLVHVTLLKPEEPH SQ HNEDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKR SQ YTSTNPNQRLPKVEILRNAIRYIESLQALLHDQDEAFYPVLEHYSGDSDASSPRSNCSDG SQ MMDYNSPPCGSRRRNSYDSSFYSDSPNDSRLGKSSVISSLDCLSSIVERISTQSPSCPVP SQ TAVDSGSEGSPCSPLQGETLSERVITIPSPSNTCTQLSQDPSSTIYHVL XX SC Swiss-Prot#P13904 XX FT 1 95 PF01586; Myogenic Basic domain. FT 1 100 SM00520; BASIC. FT 95 147 PS50888; HLH. FT 96 147 PF00010; Helix-loop-helix DNA-binding domain. FT 101 152 SM00353; finulus. XX IN T00204 E12; human, Homo sapiens. XX MX M00804 V$E2A_Q2. MX M00973 V$E2A_Q6. MX M01034 V$EBOX_Q6_01. MX M00001 V$MYOD_01. MX M00184 V$MYOD_Q6. MX M00929 V$MYOD_Q6_01. MX M02100 V$MYOD_Q6_02. XX DR TRANSPATH: MO000094763. DR EMBL: M31116; DR EMBL: X16106; DR UniProtKB: P13904; XX RN [1]; RE0000473. RX PUBMED: 2555164. RA Hopwood N. D., Pluck A., Gurdon J. B. RT MyoD expression in the forming somites is an early response to mesoderm induction in Xenopus embryos RL EMBO J. 8:3409-3417 (1989). RN [2]; RE0000759. RX PUBMED: 1648530. RA Taylor M. V., Gurdon J. B., Hopwood N. D., Towers N., Mohun T. J. RT Xenopus embryos contain a somite-specific, MyoD-like protein that binds to a promoter site required for muscle actin expression RL Genes Dev. 5:1149-1160 (1991). RN [3]; RE0003219. RX PUBMED: 1697650. RA Hopwood N. D., Gurdon J. B. RT Activation of muscle genes without myogenesis by ectopic expression of MyoD in frog embryo RL Nature 347:197-200 (1990). RN [4]; RE0003220. RX PUBMED: 1656464. RA Harvey R. P. RT Widespread expression of MyoD genes in Xenopus embryos is amplified in presumptive muscle as a delayed response to mesoderm induction RL Proc. Natl. Acad. Sci. USA 88:9198-9202 (1991). RN [5]; RE0003221. RX PUBMED: 1675156. RA Rupp R. A. W., Weintraub H. RT Ubiquitous MyoD transcription at the midblastula transition precedes induction-independent MyoD expression in presumptive mesoderm of Xenopus laevis RL Cell 65:927-937 (1991). RN [6]; RE0003224. RX PUBMED: 1322293. RA Rashbass J., Taylor M. V., Gurdon J. B. RT The DNA-binding protein E12 co-operates with XMyoD in the activation of muscle-specific gene expression in Xenopus embryos RL EMBO J. 11:2981-2990 (1992). RN [7]; RE0003243. RX PUBMED: 7926732. RA Rupp R. A. W., Snider L., Weintraub H. RT Xenopus embryos regulate the nuclear localization of XMyoD RL Genes Dev. 8:1311-1323 (1994). RN [8]; RE0004019. RX PUBMED: 8383120. RA Staudinger J., Perry M., Elledge S. J., Olson E. N. RT Interactions among vertebrate helix-loop-helix proteins in yeast using the two-hybrid system RL J. Biol. Chem. 268:4608-4611 (1993). XX //