TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T13920 XX ID T13920 XX DT 10.01.2008 (created); djp. DT 19.09.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA EAR2 XX SY COUP-TF3; ear-2; ERBAL2; NR2F6. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009995 Nr2f6. XX CL C0002; CC (rec). XX SZ 390 AA; 42.0 kDa (cDNA) (calc.). XX SQ MAMVTGGWGDPGGDTNGVDKAGGSYPRATEDDSASPPGATSDAEPGDEERPGLQVDCVVC SQ GDKSSGKHYGVFTCEGCKSFFKRTIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRV SQ GMRKEAVQRGRIPHALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEPYPAAGRFGGG SQ GAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQAALP SQ LHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDAAEYGCLKAIALFTP SQ DACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISKLFF SQ MRLVGKTPIETLIRDMLLSGSTFNWPYGSG XX SC translated from EMBL #X76654 XX FT 54 125 SM00399; c4gold. FT 54 129 PS51030; NUCLEAR_REC_DBD_2. FT 55 130 PF00105; Zinc finger, C4 type (two domains). FT 191 351 SM00430; holi. FT 194 376 PF00104; Ligand-binding domain of nuclear hormon. XX IN T27831 BCL-11A; mouse, Mus musculus. IN T09429 COUP-TF2; mouse, Mus musculus. IN T10310 COUP-TF2; Mammalia. IN T18922 ZFPM2; mouse, Mus musculus. XX MX M01728 V$EAR2_Q2. MX M08805 V$EAR2_Q4. XX BS R36818. XX DR TRANSPATH: MO000120611. DR EMBL: L25674; MMEAR2TFA. DR EMBL: X76654; MMREAR2. DR UniProtKB: P43136; EAR2_MOUSE. XX RN [1]; RE0024770. RX PUBMED: 7947324. RA Jonk L. J., de Jonge M. E., Pals C. E., Wissink S., Vervaart J. M., Schoorlemmer J., Kruijer W. RT Cloning and expression during development of three murine members of the COUP family of nuclear orphan receptors. RL Mech. Dev. 47:81-97 (1994). RN [2]; RE0024782. RX PUBMED: 8194772. RA Barnhart K. M., Mellon P. L. RT The sequence of a murine cDNA encoding Ear-2, a nuclear orphan receptor. RL Gene 142:313-314 (1994). RN [3]; RE0051652. RX PUBMED: 11382775. RA Huggins G. S., Bacani C. J., Boltax J., Aikawa R., Leiden J. M. RT Friend of GATA 2 physically interacts with chicken ovalbumin upstream promoter-TF2 (COUP-TF2) and COUP-TF3 and represses COUP-TF2-dependent activation of the atrial natriuretic factor promoter. RL J. Biol. Chem. 276:28029-28036 (2001). RN [4]; RE0051708. RX PUBMED: 10318855. RA Avram D., Ishmael J. E., Nevrivy D. J., Peterson V. J., Lee S. H., Dowell P., Leid M. RT Heterodimeric interactions between chicken ovalbumin upstream promoter-transcription factor family members ARP1 and ear2. RL J. Biol. Chem. 274:14331-14336 (1999). RN [5]; RE0052267. RX PUBMED: 10744719. RA Avram D., Fields A., Pretty On Top K., Nevrivy D. J., Ishmael J. E., Leid M. RT Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors. RL J. Biol. Chem. 275:10315-10322 (2000). XX //