TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T17830 XX ID T17830 XX DT 31.05.2010 (created); ada. DT 18.07.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Pax-1 XX SY HuP48 (human); mPax-1; mPax1; Pax-1; PAX1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009198 Pax1. XX CL C0017; paired. XX SZ 446 AA; 46.3 kDa (cDNA) (calc.), 42 kDa (SDS) XX SQ MKFTLGLGSRAWRVSWERAAAAAAGPGAGGALGSGSLRVSSRRGPRLARALPLCLSGGGG SQ ARALPDCAGPSPRRSGARQLAGPRAMEQTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQL SQ GIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDP SQ GIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGSLAQPGPYEASKQPPPQPALPYN SQ HIYQYPYPSPVSPTGTKMGTHPGVPGSAGHVSIPRSWPSAHSVSNILGIRTFMEQTGALA SQ GSEGAAYSPKMEDWAGVNRAAFPTSPAVNGLEKPALEADIKYTQSASSLSAVGGFLPACA SQ YPASNQHGVYSAPAAGYLSPGPPWPPAQAPPLTPHGAGVAVHGGELAAAMTFKHREGTDR SQ KPPSPGGKATDALGSLHGLPIPASTS XX SC Swiss-Prot#P09084 XX FT 4 128 PF00292; 'Paired box' domain. FT 4 128 SM00351; pax3. FT 4 130 PS51057; PAIRED_2. XX IN T11332 Tbx18; mouse, Mus musculus. XX MX M00326 V$PAX1_B. MX M00808 V$PAX_Q6. XX BS R02801. BS R08841. BS R08842. XX DR TRANSPATH: MO000169967. DR EMBL: M20978; MMHBPAXA. DR EMBL: M69222; MMPAX1A. DR UniProtKB: P09084; PAX1_MOUSE. XX RN [1]; RE0002787. RX PUBMED: 1889089. RA Chalepakis G., Fritsch R., Fickenscher H., Deutsch U., Goulding M., Gruss P. RT The molecular basis of the undulated/Pax-1 mutation RL Cell 66:873-884 (1991). RN [2]; RE0002788. RX PUBMED: 3180219. RA Balling R., Deutsch U., Gruss P. RT undulated, a mutation affecting the development of the mouse skeleton, has a point mutation in the paired box of Pax 1 RL Cell 55:531-535 (1988). RN [3]; RE0002789. RX PUBMED: 2453291. RA Deutsch U., Dressler G. R., Gruss P. RT Pax 1, a member of a paired box homologous murine gene family, is expressed in segmented structures during development RL Cell 53:617-625 (1988). RN [4]; RE0004244. RX PUBMED: 8099544. RA Maulbecker C. C., Gruss P. RT The oncogenic potential of Pax genes RL EMBO J. 12:2361-2367 (1993). RN [5]; RE0014119. RX PUBMED: 7875377. RA Dietrich S., Gruss P. RT undulated phenotypes suggest a role of Pax-1 for the development of vertebral and extravertebral structures RL Dev. Biol. 167:529-548 (1995). RN [6]; RE0014279. RX PUBMED: 8026324. RA Wallin J., Wilting J., Koseki H., Fritsch R., Christ B., Balling R. RT The role of Pax-1 in axial skeleton development RL Development 120:1109-1121 (1994). RN [7]; RE0014283. RX PUBMED: 7649395. RA Neubueser A., Koseki H., Balling R. RT Characterization and developmental expression of Pax9, a paired-box-containing gene related to Pax1 RL Dev. Biol. 170:701-716 (1995). RN [8]; RE0014313. RX PUBMED: 8625814. RA Song D. L., Chalepakis G., Gruss P., Joyner A. L. RT Two Pax-binding sites are required for early embryonic brain expression of an Engrailed-2 transgene RL Development 122:627-635 (1996). RN [9]; RE0066970. RX PUBMED: 18644785. RA Farin H. F., Mansouri A., Petry M., Kispert A. RT T-box protein Tbx18 interacts with the paired box protein Pax3 in the development of the paraxial mesoderm. RL J. Biol. Chem. 283:25372-25380 (2008). XX //