TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00055 XX ID T00055 XX DT 15.04.1993 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Bdp1p XX SY BDP1; TFC5; TFIIIB-p90; YNL039W. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004158 BDP1. XX SZ 594 AA; 67.7 kDa (cDNA) (calc.). XX SQ MSSIVNKSGTRFAPKVRQRRAATGGTPTPKPRTPQLFIPESKEIEEDNSDNDKGVDENET SQ AIVEKPSLVGERSLEGFTLTGTNGHDNEIGDEGPIDASTQNPKADVIEDNVTLKPAPLQT SQ HRDQKVPRSSRLASLSKDNESRPSFKPSFLDSSSNSNGTARRLSTISNKLPKKIRLGSIT SQ ENDMNLKTFKRHRVLGKPSSAKKPAGAHRISIVSKISPPTAMTDSLDRNEFSSETSTSRE SQ ADENENYVISKVKDIPKKVRDGESAKYFIDEENFTMAELCKPNFPIGQISENFEKSKMAK SQ KAKLEKRRHLRELRMRARQEFKPLHSLTKEEQEEEEEKRKEERDKLLNADIPESDRKAHT SQ AIQLKLNPDGTMAIDEETMVVDRHKNASIENEYKEKVDENPFANLYNYGSYGRGSYTDPW SQ TVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLPPN SQ FDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEIEEAKNTAKEEDQTAQRLNDANLNK SQ KGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKLKERNNDDNEDNEGSEEEPEIDQ XX SC Swiss-Prot#P46678 XX FT 35 338 PF00478; IMP dehydrogenase / GMP reductase dom. FT 416 464 SM00717; sant. FT 417 462 PF00249; Myb-like DNA-binding domain. XX FF pol III transcription factor; FF constituent of yeast TFIIIB; XX IN T00798 Spt15p; yeast, Saccharomyces cerevisiae. XX DR EMBL: U31819; DR EMBL: U37533; DR EMBL: U38415; DR EMBL: Z71315; DR UniProtKB: P46678; XX RN [1]; RE0000223. RX PUBMED: 1458536. RA Kassavetis G. A., Joazeiro C. A. P., Pisano M., Geiduschek E. P., Colbert T., Hahn S., Blanco J. A. RT The role of the TATA-binding protein in the assembly and function of the multisubunit yeast RNA polymerase III transcription factor, TFIIIB RL Cell 71:1055-1064 (1992). RN [2]; RE0013094. RX PUBMED: 7568218. RA Kassavetis G. A., Nguyen S. T., Kobayashi R., Kumar A., Geiduschek E. P., Pisano M. RT Cloning, expression, and function of TFC5, the gene encoding the B' component of the Saccharomyces cerevisiae RNA polymerase III transcription factor TFIIIB RL Proc. Natl. Acad. Sci. USA 92:9786-9790 (1995). RN [3]; RE0014905. RX PUBMED: 8617241. RA Ruth J., Conesa C., Dieci G., Lefebvre O., Dusterhoft A., Ottonello S., Sentenac A. RT A suppressor of mutations in the class III transcription system encodes a component of yeast TFIIIB RL EMBO J. 15:1941-1949 (1996). XX //