
AC T00798
XX
ID T00798
XX
DT 15.10.1992 (created); ewi.
DT 29.11.2012 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Spt15p
XX
SY SPT15; TATA-binding protein; TBP; TBP1; TFIID; TFIIDtau; yBTF1.
XX
OS yeast, Saccharomyces cerevisiae
OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
GE G051930 SPT15.
XX
CL C0082; TATA; F4.6.1.0.1.
XX
SZ 240 AA; 27.0 kDa (gene) (calc.), 27 kDa (SDS) [2] [24], 28 kDa (GF) [24] [24] [2]
XX
SQ MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSAT
SQ SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGK
SQ MVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHG
SQ TFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
XX
SC Swiss-Prot#P13393
XX
FT 62 147
PF00352; Transcription factor TFIID (or TATA-binding.
FT 63 240
DNA-binding and trans-activating domain (bipartite) [7].
FT 152 238
PF00352; Transcription factor TFIID (or TATA-binding.
FT 171 211
sigma 2.4-homology [18].
XX
SF pI 9.4 (predicted);
SF saddle-like molecular structure, binding DNA as a monomer [7];
SF formation of Spt15p oligomers [53];
SF contacting the minor groove and bending of the DNA by an angle of about 80 to 90 [53] [27];
SF bipartite DNA-binding domain comprising the two direct repeats within the conserved core region [48] [8];
SF direct repeats exhibit some homology with bacterial integrating host factors (IHF) [40];
SF subtle differences between the core regions of human, S. c. and S. pombe Spt15p confer slightly distinct functional properties [46] [47];
SF mutants with altered functional properties: I143N inactive;
SF P65S active only with pol I;
SF T112K largely reduced activity with pol II;
SF K133,138L and K133,145L: no interaction with TFIIA;
SF E188N inactive with pol II only;
SF E188Y and P: active only in pol III system, more efficient in 5S transcription than for tRNA synthesis;
SF F190Q: active for pol III only;
SF mutants in the region 190-205 may exhibit altered DNA-binding specificity (tGtaaa instead of tAtaaa) [15] [50];
SF the N-terminal part influence DNA-binding by increasing the induced bending angle and by destabilizing the Spt15p-TATA complex [22];
SF however, it has been reported that the extent of bending by Spt15p correlates with the stability of the Spt15p-TATA complex [36];
SF Spt15p is part of a large complex with at least seven Spt15p-associated factors (TAF) between 25 and 150 kDa [33];
SF interaction with TFIIA increases the stability of Spt15p-TATA by relieving the inhibitory effect of the Spt15p N-terminus and decreases the influence of TATA-flanking sequences [49];
SF TFIIA contacts the N-terminal "stirrup" of the Spt15p saddle [38];
SF this region is also tackled by a negative regulator, Dr1/NC2 [39];
SF holo-TFIID and Spt15p are contacted by acidic trans-activation domains [21];
SF in the case of Spt15p/VP16, the dissociation constant is 200 nM [20];
SF this interaction involves Leu-114 [54];
XX
FF activator of all three polymerases;
FF binds into the minor groove and bends DNA;
FF in mammalian cell extracts, yeast holo-TFIID is active [43] [17];
FF cloned yeast Spt15p supports only basal transcription, not activation by upstream factors [44] [26];
FF Spt15p recruitment to the TATA box is generally enhanced by upstream factors [34] [35];
FF pol III activation through the TFIIIB complex Spt15p-BRF+B';
FF pol I activation as part of SL1 [32];
FF Spt15p helps HSF to bind to nucleosome-assembled DNA;
XX
IN T00055 Bdp1p; yeast, Saccharomyces cerevisiae.
IN T00068 Brf1p; yeast, Saccharomyces cerevisiae.
IN T00182 DBF4; human, Homo sapiens.
IN T01784 MEF-2A; clawed frog, Xenopus laevis.
IN T00530 NC1; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T00715 Rap1p; yeast, Saccharomyces cerevisiae.
IN T00759 Sp1; human, Homo sapiens.
IN T00798 Spt15p; yeast, Saccharomyces cerevisiae.
IN T00819 Sua7p; yeast, Saccharomyces cerevisiae.
IN T01269 Taf2p; yeast, Saccharomyces cerevisiae.
IN T00815 TFIIA; yeast, Saccharomyces cerevisiae.
IN T00894 Vmw65; HSV-1, herpes simplex virus type 1.
XX
MX M01524 F$TBP_01.
MX M00713 F$TBP_Q6.
XX
BS R00367.
BS R01001.
BS R01014.
BS R01015.
BS R01016.
BS R03156.
BS R36445.
BS R36446.
BS R01764.
BS R01732.
BS R03165.
BS R03331.
BS R03747.
BS R03840.
BS R03841.
BS R03842.
BS R03843.
BS R03844.
BS R22999.
BS R29463.
BS R32751.
BS R00047.
BS R03080.
BS R00705.
BS R03167.
BS R29452.
BS R03173.
BS R08480.
BS R03809.
BS R03810.
BS R03811.
BS R03814.
BS R03815.
BS R03172.
BS R03161.
BS R03162.
BS R03164.
BS R03812.
BS R03813.
BS R00970.
BS R03163.
BS R36441.
BS R36442.
BS R36443.
BS R36444.
BS R32986.
BS R32987.
BS R32988.
BS R32989.
BS R32990.
BS R32991.
BS R32992.
BS R32993.
BS R22627.
BS R22836.
BS R22841.
BS R23018.
BS R28229.
XX
DR EMBL: M26403;
DR EMBL: M27135;
DR EMBL: M29459;
DR EMBL: U18917;
DR EMBL: X16860;
DR UniProtKB: P13393;
DR PDB: 1TBP.
DR PDB: 1YTB.
DR PDB: 1YTF.
XX
RN [1]; RE0000039.
RX PUBMED: 2917366.
RA Buratowski S., Hahn S., Guarente L., Sharp P. A.
RT Five Intermediate Complexes in Transcription Initiation by RNA Polymerase II
RL Cell 56:549-561 (1989).
RN [2]; RE0000102.
RX PUBMED: 2550146.
RA Hahn S., Buratowski S., Sharp P. A., Guarente L.
RT Isolation of the gene encoding the yeast TATA binding protein TFIID: A gene identical to the SPT15 suppressor of Ty element insertions
RL Cell 58:1173-1181 (1989).
RN [3]; RE0000218.
RX PUBMED: 1586948.
RA Schultz M. C., Reeder R. H., Hahn S.
RT Variants of the TATA-binding protein can distinguish subsets of RNA polymerase I, II, and III promoters
RL Cell 69:697-702 (1992).
RN [4]; RE0000219.
RX PUBMED: 1586947.
RA Cormack B. P., Struhl K.
RT The TATA-binding protein is required for transcription by all three nuclear RNA polymerases in yeast cells
RL Cell 69:685-696 (1992).
RN [5]; RE0000223.
RX PUBMED: 1458536.
RA Kassavetis G. A., Joazeiro C. A. P., Pisano M., Geiduschek E. P., Colbert T., Hahn S., Blanco J. A.
RT The role of the TATA-binding protein in the assembly and function of the multisubunit yeast RNA polymerase III transcription factor, TFIIIB
RL Cell 71:1055-1064 (1992).
RN [6]; RE0000224.
RX PUBMED: 2673545.
RA Eisenmann D. M., Dollard C., Winston F.
RT SPT15, the gene encoding the yeast TATA binding factor TFIID, is required for normal transcription initiation in vivo
RL Cell 58:1183-1191 (1989).
RN [7]; RE0000225.
RX PUBMED: 2194665.
RA Horikoshi M., Yamamoto T., Ohkuma Y., Weil P. A., Roeder R. G.
RT Analysis of structure-function relationships of yeast TATA box binding factor TFIID
RL Cell 61:1171-1178 (1990).
RN [8]; RE0000226.
RX PUBMED: 2015629.
RA Reddy P., Hahn S.
RT Dominant negative mutations in yeast TFIID define a bipartite DNA-binding region
RL Cell 65:349-357 (1991).
RN [9]; RE0000228.
RX PUBMED: 1760848.
RA Lee D. K., Horikoshi M., Roeder R. G.
RT Interaction of TFIID in the minor groove of the TATA element
RL Cell 67:1241-1250 (1991).
RN [10]; RE0000229.
RX PUBMED: 1934060.
RA Meisterernst M., Roeder R. G.
RT Family of proteins that interact with TFIID and regulate promoter activity
RL Cell 67:557-567 (1991).
RN [11]; RE0000439.
RX PUBMED: 2684641.
RA Hahn S., Buratowski S., Sharp P. A., Guarente L.
RT Identification of a yeast protein homologous in function to the mammalian general transcription factor, TFIIA
RL EMBO J. 8:3379-3382 (1989).
RN [12]; RE0000747.
RX PUBMED: 2253881.
RA Carcamo J., Maldonado E., Cortes P., Ahn M.-H., Ha I., Flint J., Reinberg D.
RT A TATA-like sequence located downstream of the transcription initiation site is required for expression of an RNA polymerase II transcribed gene
RL Genes Dev. 4:1611-1622 (1990).
RN [13]; RE0000760.
RX PUBMED: 2065977.
RA Taylor I. C. A., Workman J. L., Schuetz T. J., Kingston R. E.
RT Facilitated binding of GAL4 and heat shock factor to nucleosomal templates: differential function of DNA-binding domains
RL Genes Dev. 5:1285-1298 (1991).
RN [14]; RE0000975.
RX PUBMED: 8428901.
RA Truant R., Xiao H., Ingles C. J., Greenblatt J.
RT Direct interaction between the transcriptional activation domain of human p53 and the TATA box-binding protein
RL J. Biol. Chem. 268:2284-2287 (1993).
RN [15]; RE0001068.
RX PUBMED: 8444878.
RA Poon D., Knittle R. A., Sabelko K. A., Yamamoto T., Horikoshi M., Roeder R. G., Weil P. A.
RT Genetic and biochemical analyses of yeast TATA-binding protein mutants
RL J. Biol. Chem. 268:5005-5013 (1993).
RN [16]; RE0001375.
RX PUBMED: 2677669.
RA Schmidt M. C., Zhou Q., Berk A. J.
RT Sp1 Activates Transcription without Enhancing DNA-Binding Activity of the TATA Box Factor
RL Mol. Cell. Biol. 9:3299-3307 (1989).
RN [17]; RE0001876.
RX PUBMED: 3290687.
RA Buratowski S., Hahn S., Sharp P. A., Guarente L.
RT Function of a yeast TATA element-binding protein in a mammalian transcription system
RL Nature 334:37-42 (1988).
RN [18]; RE0001877.
RX PUBMED: 2677740.
RA Horikoshi M., Wang C. K., Fuji H., Cromlish J. A., Weil P. A., Roeder R. G.
RT Cloning and structure of a yeast gene encoding a general transcription initiation factor TFIID that binds to the TATA box
RL Nature 341:299-303 (1989).
RN [19]; RE0001880.
RX PUBMED: 2234067.
RA Nakatani Y., Horikoshi M., Brenner M., Yamamoto T., Besnard F., Roeder R. G., Freese E.
RT A downstream initiation element required for efficient TATA box binding and in vitro function of TFIID
RL Nature 348:86-88 (1990).
RN [20]; RE0001881.
RX PUBMED: 1646402.
RA Ingles C. J., Shales M., Cress W. D., Triezenberg S. J., Greenblatt J.
RT Reduced binding of TFIID to transcriptionally compromised mutants of VP16
RL Nature 351:588-590 (1991).
RN [21]; RE0001882.
RX PUBMED: 2193231.
RA Stringer K. F., Ingles C. J., Greenblatt J.
RT Direct and selective binding of an acidic transcriptional activation domain to the TATA-box factor TFIID
RL Nature 345:783-786 (1990).
RN [22]; RE0002203.
RX PUBMED: 8493098.
RA Kuddus R., Schmidt M. C.
RT Effect of the non-conserved N-terminus on the DNA binding activity of the yeast TATA binding protein
RL Nucleic Acids Res. 21:1789-1796 (1993).
RN [23]; RE0002472.
RX PUBMED: 1849267.
RA Kaufman P. D., Rio D. C.
RT Drosophila P-element transposase is a transcriptional repressor in vitro
RL Proc. Natl. Acad. Sci. USA 88:2613-2317 (1991).
RN [24]; RE0002497.
RX PUBMED: 2662184.
RA Horikoshi M., Wang C. K., Fuji H., Cromlish J. A., Weil P. A., Roeder R. G.
RT Purification of a yeast TATA box-binding protein that exhibits human transcription factor IID activity
RL Proc. Natl. Acad. Sci. USA 86:4843-4847 (1989).
RN [25]; RE0002498.
RX PUBMED: 2569738.
RA Hahn S., Buratowski S., Sharp P. A., Guarente L.
RT Yeast TATA-binding protein TFIID binds to TATA elements with both consensus and nonconsensus DNA sequences
RL Proc. Natl. Acad. Sci. USA 86:5718-5722 (1989).
RN [26]; RE0002500.
RX PUBMED: 2251259.
RA Kambadur R., Culotta V., Hamer D.
RT Cloned yeast and mammalian transcription factor TFIID gene products support basal but not activated metallothionein gene transcription
RL Proc. Natl. Acad. Sci. USA 87:9168-9142 (1990).
RN [27]; RE0002501.
RX PUBMED: 1736286.
RA Horikoshi M., Bertuccioli C., Takada R., Wang C. K., Yamamoto T., Roeder R. G.
RT Transcription factor TFIID induces DNA bending upon binding to the TATA element
RL Proc. Natl. Acad. Sci. USA 89:1060-1064 (1992).
RN [28]; RE0002551.
RX PUBMED: 2682626.
RA Schmidt M. C., Kao C. C., Pei R., Berk A. J.
RT Yeast TATA-box transcription factor gene
RL Proc. Natl. Acad. Sci. USA 86:7785-7789 (1989).
RN [29]; RE0002683.
RX PUBMED: 1546314.
RA Buratowski S., Zhou H.
RT Transcription factor IID mutants defective for interaction with transcription factor IIA
RL Science 255:1130-1132 (1992).
RN [30]; RE0004141.
RX PUBMED: 8264638.
RA Leibham D., Wong M.-W., Cheng T.-C., Schroeder S., Weil P. A., Olson E. N., Perry M.
RT Binding of TFIID and MEF2 to the TATA element activates transcription of the Xenopus MyoDa promoter
RL Mol. Cell. Biol. 14:686-699 (1994).
RN [31]; RE0005510.
RX PUBMED: 7939664.
RA Klein C., Struhl K.
RT Increased recruitment of TATA-binding protein to the promoter by transcriptional activation domains in vivo
RL Science 266:280-282 (1994).
RN [32]; RE0005511.
RX PUBMED: 7966304.
RA Rudloff U., Strunnenberg H. G., Keaveney M., Grummt I.
RT Yeast TBP can replace its human homologue in the RNA polymerase I-specific multisubunit factor SL1
RL J. Mol. Biol. 243:840-845 (1994).
RN [33]; RE0005512.
RX PUBMED: 7667272.
RA Poon D., Bai Y., Campbell A. M., Bjorklund S., Kim Y.-J., Zhou S., Kornberg R. D., Weil P. A.
RT Identification and characterization of a TFIID-like multiprotein complex from Saccharomyces cerevisiae
RL Proc. Natl. Acad. Sci. USA 92:8224-8228 (1995).
RN [34]; RE0005513.
RX PUBMED: 7723828.
RA Chatterjee S., Struhl K.
RT Connecting a promoter-bound protein to TBP bypasses the need for a transcriptional activation domain
RL Nature 374:820-822 (1995).
RN [35]; RE0005514.
RX PUBMED: 7723829.
RA Klages N., Strubin M.
RT Stimulation of RNA polymerase II transcription initiation by recruitment of TBP in vivo
RL Nature 374:822-823 (1995).
RN [36]; RE0005515.
RX PUBMED: 7616566.
RA Starr D. B., Hoopes B. C., Hawley D. K.
RT DNA bending is an important component of site-specific recognition by the TATA binding protein
RL J. Mol. Biol. 250:434-446 (1995).
RN [37]; RE0005516.
RX PUBMED: 7604282.
RA Stargell L. A., Struhl K.
RT The TBP-TFII interaction in the response to acidic activators in vivo
RL Science 269:75-78 (1995).
RN [38]; RE0005517.
RX PUBMED: 8610010.
RA Tan S., Hunziker Y., Sargent D. F., Richmond T. J.
RT Crystal structure of a yeast TFIIA/TBP/DNA complex
RL Nature 381:127-134 (1996).
RN [39]; RE0005518.
RX PUBMED: 7738039.
RA Kim T. K., Zhao Y., Ge H., Bernstein R., Roeder R. G.
RT TATA-binding protein residues implicated in a functional interplay between negative cofactor NC2(Dr1) and general factors TFIIA and TFIIB
RL J. Biol. Chem. 270:10976-10981 (1995).
RN [40]; RE0005548.
RX PUBMED: 1760837.
RA Nash H. A., Granston A. E.
RT Similarity between the DNA-binding domains of IHF protein and TFIID protein
RL Cell 67:1037-1038 (1991).
RN [41]; RE0005549.
RX PUBMED: 1310667.
RA Kelleher III R. J., Flanagan P. M., Chasman D. I., Ponticelli A. S., Struhl K., Kornberg R. D.
RT Yeast and human TFIIDs are interchangeable for the response to acidic transcriptional activators in vitro
RL Genes Dev. 6:296-303 (1992).
RN [42]; RE0005555.
RX PUBMED: 7958931.
RA Tansey W. P., Ruppert S., Tjian R., Herr W.
RT Multiple regions of TBP participate in the response to transcriptional activators in vivo
RL Genes Dev. 8:2756-2769 (1994).
RN [43]; RE0005572.
RX PUBMED: 3290688.
RA Cavallini B., Huet J., Plassat J. L., Sentenac A., Egly J. M., Chambon P.
RT A yeast activity can substitute for the HeLa cell TATA box factor
RL Nature 334:77-80 (1988).
RN [44]; RE0005573.
RX PUBMED: 2251256.
RA Meisterernst M., Horikoshi M., Roeder R. G.
RT Recombinant yeast TFIID, a general transcription factor, mediates activation by the gene-specific factor USF in a chromatin assembly assay
RL Proc. Natl. Acad. Sci. USA 87:9153-9157 (1990).
RN [45]; RE0005574.
RX PUBMED: 2197558.
RA Fikes J. D., Becker D. M., Winston F., Guarente L.
RT Striking conservation of TFIID in Schizosaccharomyces pombe and Saccharomyces cerevisiae
RL Nature 346:291-294 (1990).
RN [46]; RE0005575.
RX PUBMED: 2015628.
RA Cormack B. P., Strubin M., Ponticelli A. S., Struhl K.
RT Functional differences between yeast and human TFIID are localized to the highly conserved region
RL Cell 65:341-348 (1991).
RN [47]; RE0005576.
RX PUBMED: 2015627.
RA Gill G., Tjian R.
RT A highly conserved domain of TFIID displays species specificity in vivo
RL Cell 65:333-340 (1991).
RN [48]; RE0005577.
RX PUBMED: 1557391.
RA Yamamoto T., Horikoshi M., Wang J., Hasegawa S., Weil P. A., Roeder R. G.
RT A bipartite DNA binding domain composed of direct repeats in the TATA box binding factor TFIID
RL Proc. Natl. Acad. Sci. USA 89:2844-2848 (1992).
RN [49]; RE0005578.
RX PUBMED: 1406690.
RA Lee D. K., Dejong J., Hashimoto S., Horikoshi M., Roeder R. G.
RT TFIIA induces conformational changes in TFIID via interactions with the basic repeat
RL Mol. Cell. Biol. 12:5189-5196 (1992).
RN [50]; RE0005579.
RX PUBMED: 1739977.
RA Strubin M., Struhl K.
RT Yeast and human TFIID with altered DNA-binding specificity for TATA elements
RL Cell 68:721-730 (1992).
RN [51]; RE0005580.
RX PUBMED: 8491381.
RA Auble D. T., Hahn S.
RT An ATP-dependent inhibitor of TBP binding to DNA
RL Genes Dev. 7:844-856 (1993).
RN [52]; RE0005581.
RX PUBMED: 7926734.
RA Cormack B. P., Strubin M., Stargell L. A., Struhl K.
RT Conserved and nonconserved functions of the yeast and human TATA-binding proteins
RL Genes Dev. 8:1335-1343 (1994).
RN [53]; RE0005582.
RX PUBMED: 7533216.
RA Griffith J. D., Makhov A., Zawel L., Reinberg D.
RT Visualization of TBP oligomers binding and bending the HIV-1 and Adeno promoters
RL J. Mol. Biol. 246:576-584 (1995).
RN [54]; RE0005583.
RX PUBMED: 8183347.
RA Kim T. K., Hashimoto S., Kelleher III R. J., Flanagan P. M., Kornberg R. D., Horikoshi M., Roeder R. G.
RT Effects of activation-defective TBP mutations on transcription initiation in yeast
RL Nature 369:252-255 (1994).
XX
//