AC T00715
XX
ID T00715
XX
DT 15.10.1992 (created); ewi.
DT 27.07.2015 (updated); hna.
CO Copyright (C), QIAGEN.
XX
FA Rap1p
XX
SY GRF-1; GRFI; RAP1; Rap1p; repressor-activator binding protein; SBF-E; TUF; YNL216W.
XX
OS yeast, Saccharomyces cerevisiae
OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
GE G000965 RAP1.
XX
CL C0022; trp; F3.5.1.2.5.
XX
SZ 827 AA; 92.4 kDa (gene) (calc.), 135 kDa (SDS), 300 kDa (GF)
XX
SQ MSSPDDFETAPAEYVDALDPSMVVVDSGSAAVTAPSDSAAEVKANQNEENTGATAAETSE
SQ KVDQTEVEKKDDDDTTEVGVTTTTPSIADTAATANIASTSGASVTEPTTDDTAADEKKEQ
SQ VSGPPLSNMKFYLNRDADAHDSLNDIDQLARLIRANGGEVLDSKPRESKENVFIVSPYNH
SQ TNLPTVTPTYIKACCQSNSLLNMENYLVPYDNFREVVDSRLQEESHSNGVDNSNSNSDNK
SQ DSIRPKTEIISTNTNGATEDSTSEKVMVDAEQQARLQEQAQLLRQHVSSTASITSGGHND
SQ LVQIEQPQKDTSNNNNSNVNDEDNDLLTQDNNPQTADEGNASFQAQRSMISRGALPSHNK
SQ ASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYE
SQ VDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSL
SQ ITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENA
SQ WRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRAR
SQ NYSSQRNVQPTANAASANAAAAAAAAASNSYAIPENELLDEDTMNFISSLKNDLSNISNS
SQ LPFEYPHEIAEAIRSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKL
SQ HEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPP
SQ PNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL
XX
SC Swiss-Prot#P11938
XX
FT 55 422 
PF00478; IMP dehydrogenase / GMP reductase dom.
FT 121 195 
PF00533; BRCA1 C Terminus (BRCT) domain.
FT 121 208 
PS50172; BRCT.
FT 123 198 
SM00292; BRCT_7.
FT 355 411 
PS50090; MYB_3.
FT 359 413 
SM00717; sant.
FT 360 411 
PF00249; Myb-like DNA-binding domain.
FT 361 596 
DNA binding domain [15].
FT 630 695 
activation domain [15].
XX
SF MW may vary between 120-150 kDa when determined by SDS-PAGE [1];
SF C-terminal region is essential for telomere position effects, silencing at the HM loci and repression of ribosomal protein genes [15];
XX
FF By increasing accessibility to GCN4, BAS1 and BAS2 transactivates the HIS4 promoter [18];
FF Strongly inhibits cell growth [19];
FF repressor or activator, depending on context;
FF transcription factor, look up the TRANSFAC cross reference for more details;
FF activates glycolytic genes, represses silent mating loci HML and HMR;
FF activates most but not all ribosomal protein genes [15];
FF participates in the repression of all ribosomal protein genes in response to a secretory defect [15];
FF involved in telomer and protein stability;
FF Gcr2p homodimer formation is essential for activation of most ribosomal protein and glycolytic genes by Rap1p T00715/Gcr1p [16];
FF binding to matrix attachment regions is necessary for loop formation at the HML locus [17];
XX
IN T10720 Gcr1p; yeast, Saccharomyces cerevisiae.
IN T00798 Spt15p; yeast, Saccharomyces cerevisiae.
XX
MX M01573 F$RAP1_01.
MX M01637 F$RAP1_02.
MX M01787 F$RAP1_03.
MX M00213 F$RAP1_C.
MX M01828 F$RAP1_Q6.
XX
BS R29711.
BS R29712.
BS R31978.
BS R68953.
BS R68955.
BS R68956.
BS R68957.
BS R68958.
BS R68959.
BS R68960.
BS R68961.
BS R68962.
BS R68963.
BS R68964.
BS R68965.
BS R68966.
BS R68967.
BS R68968.
BS R68969.
BS R68970.
BS R68971.
BS R68972.
BS R68973.
BS R68974.
BS R68975.
BS R68976.
BS R68977.
BS R68978.
BS R68979.
BS R68980.
BS R68981.
BS R68982.
BS R68983.
BS R68984.
BS R68985.
BS R68986.
BS R68987.
BS R68988.
BS R68989.
BS R68990.
BS R68991.
BS R68992.
BS R68993.
BS R68994.
BS R68995.
BS R68996.
BS R68997.
BS R68998.
BS R33010.
BS R02393.
BS R02394.
BS R02395.
BS R02761.
BS R02762.
BS R02763.
BS R02764.
BS R02765.
BS R02766.
BS R02767.
BS R02768.
BS R02769.
BS R02770.
BS R02771.
BS R02772.
BS R02773.
BS R01924.
BS R03739.
BS R22445.
BS R00073.
BS R29709.
BS R24748.
BS R00166.
BS R30875.
BS R30876.
BS R30877.
BS R30879.
BS R30880.
BS R24233.
BS R28219.
BS R00415.
BS R00416.
BS R02799.
BS R03807.
BS R12341.
BS R29656.
BS R00714.
BS R30881.
BS R00717.
BS R00972.
BS R01019.
BS R12344.
BS R02917.
BS R01199.
BS R01210.
BS R01289.
BS R02417.
BS R03676.
BS R24488.
BS R24489.
BS R24490.
BS R24492.
BS R01820.
BS R01822.
BS R01332.
BS R01333.
BS R01334.
BS R01335.
BS R03124.
BS R01331.
BS R36439.
BS R36440.
BS R01337.
BS R01338.
BS R29635.
BS R01356.
BS R24496.
BS R00372.
BS R00373.
BS R24235.
BS R03788.
BS R04074.
XX
DR SMARTDB: SB000097.
DR EMBL: M18068;
DR UniProtKB: P11938;
DR PDB: 1ign.
XX
RN [1]; RE0000103.
RX PUBMED: 3315231.
RA Shore D., Nasmyth K.
RT Purification and Cloning of a DNA Binding Protein from Yeast That Binds to Both Silencer and Activator Elements
RL Cell 51:721-732 (1987).
RN [2]; RE0000330.
RX PUBMED: 2548856.
RA Sousa R., Arcangioli B.
RT A point mutation in the CYC1 UAS1 creates a new combination of regulatory elements that activate transcription synergistically
RL EMBO J. 8:1801-1808 (1989).
RN [3]; RE0000340.
RX PUBMED: 3912170.
RA Huet J., Cottrelle P., Cool M., Vignais M.-L., Thiele D., Marck C., Buhler J.-M., Sentenac A., Fromageot P.
RT A general upstream binding factor for genes of the yeast translational apparatus
RL EMBO J. 4:3539-3547 (1985).
RN [4]; RE0000358.
RX PUBMED: 15981337.
RA Shore D., Stillman D. J., Brand A. H., Nasmyth K. A.
RT Identification of silencer binding proteins from yeast: possible roles in SIR control and DNA replication
RL EMBO J. 6:461-467 (1987).
RN [5]; RE0000359.
RX PUBMED: 3046937.
RA Kimmerly W., Buchman A., Kornberg R., Rine J.
RT Roles of two DNA-binding factors in replication, segregation and transcriptional repression mediated by a yeast silencer
RL EMBO J. 7:2241-2253 (1988).
RN [6]; RE0000402.
RX PUBMED: 3301327.
RA Vignais M.-L., Woudt L. P., Wassenaar G. M., Mager W. H., Sentenac A., Planta R. J.
RT Specific binding of TUF factor to upstream activation sites of yeast ribosomal protein genes
RL EMBO J. 6:1451-1457 (1987).
RN [7]; RE0000737.
RX PUBMED: 2010087.
RA Kurtz S., Shore D.
RT RAP1 protein activates and silences transcription of mating-type genes in yeast
RL Genes Dev. 5:616-628 (1991).
RN [8]; RE0000949.
RX PUBMED: 2201690.
RA Vignais M.-L., Huet J., Buhler J.-M., Sentenac A.
RT Contacts between the factor TUF and RPG sequences
RL J. Biol. Chem. 256:14669-14674 (1990).
RN [9]; RE0001211.
RX PUBMED: 3072472.
RA Buchman A. R., Lue N. F., Kornberg R. D.
RT Connections between Transcriptional Activators, Silencers, and Telomeres as Revealed by Functional Analysis of a Yeast DNA-Binding Protein
RL Mol. Cell. Biol. 8:5086-5099 (1988).
RN [10]; RE0001281.
RX PUBMED: 3275867.
RA Buchman A. R., Kimmerley W. J., Rine J., Kornberg R. D.
RT Two DNA-Binding Factors Recognize Specific Sequences at Silencers, Upstream Activating Sequences, Autonomously Replicating Sequences, and Telomeres in Saccharomyces cerevisiae
RL Mol. Cell. Biol. 8:210-225 (1988).
RN [11]; RE0001411.
RX PUBMED: 2685560.
RA Hurd H. K., Roberts J. W.
RT Upstream Regulatory Sequences of the Yeast RNR2 Gene Include a Repression Sequence and an Activation Site That Binds the RAP1 Protein
RL Mol. Cell. Biol. 9:5359-5372 (1989).
RN [12]; RE0001413.
RX PUBMED: 2685568.
RA Chambers A., Tsang J. S. H., Stanway C., Kingsman A. J., Kingsman S. M.
RT Transcriptional Control of the Saccharomyces cerevisiae PGK Gene by RAP1
RL Mol. Cell. Biol. 9:5516-5524 (1989).
RN [13]; RE0001416.
RX PUBMED: 2405258.
RA Santangelo G. M., Tornow J.
RT Efficient Transcription of the Glycolytic Gene ADH1 and Three Translational Component Genes Requires the GCR1 Product, Which Can Act Through TUF/GRF/RAP Binding Sites
RL Mol. Cell. Biol. 10:859-862 (1990).
RN [14]; RE0001626.
RX PUBMED: 2017175.
RA Moehle C. M., Hinnebusch A. G.
RT Association of RAP1 binding sites with stringent control of ribosomal protein gene transcription in Saccharomyces cerevisiae
RL Mol. Cell. Biol. 11:2723-2735 (1991).
RN [15]; RE0006887.
RX PUBMED: 9461469.
RA Mizuta K., Tsujii R., Warner J. R., Nishiyama M.
RT The C-terminal silencing domain of Rap1p is essential for the repression of ribosomal protein genes in response to a defect in the secretory pathway
RL Nucleic Acids Res. 26:1063-1069 (1998).
RN [16]; RE0017624.
RX PUBMED: 11333224.
RA Deminoff S. J., Santangelo G. M.
RT Rap1p requires Gcr1p and Gcr2p homodimers to activate ribosomal protein and glycolytic genes, respectively.
RL Genetics 158:133-143 (2001).
RN [17]; RE0023942.
RX PUBMED: 2655930.
RA Hofmann J. F., Laroche T., Brand A. H., Gasser S. M.
RT RAP-1 factor is necessary for DNA loop formation in vitro at the silent mating type locus HML
RL Cell 57:725-737 (1989).
RN [18]; RE0064759.
RX PUBMED: 1904543.
RA Devlin C., Tice-Baldwin K., Shore D., Arndt K. T.
RT RAP1 is required for BAS1/BAS2- and GCN4-dependent transcription of the yeast HIS4 gene.
RL Mol. Cell. Biol. 11:3642-3651 (1991).
RN [19]; RE0066513.
RX PUBMED: 8601471.
RA Freeman K., Gwadz M., Shore D.
RT Molecular and genetic analysis of the toxic effect of RAP1 overexpression in yeast.
RL Genetics 141:1253-1262 (1995).
XX
//