TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00819 XX ID T00819 XX DT 15.10.1992 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Sua7p XX SY factor e; SUA7; SUA7p; TFIIB; YPR086W. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004182 SUA7. XX SZ 345 AA; 38.2 kDa (cDNA) (calc.), 41 kDa (SDS) XX SQ MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTR SQ SEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMD SQ KKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGC SQ RRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIP SQ RFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ SQ TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK XX SC Swiss-Prot#P29055 XX FT 69 335 PF00478; IMP dehydrogenase / GMP reductase domain. FT 131 212 SM00385; cyclin_7. FT 133 203 PF00382; Transcription factor TFIIB repeat. FT 237 318 SM00385; cyclin_7. FT 239 309 PF00382; Transcription factor TFIIB repeat. XX SF 58% and 65% similarity of the two imperfect repeats with those of human TFIIB [3]; SF pI(calc.) = 8.64 [3]; SF mutations in positions 62 and 78 can be suppressed by mutations in SUB1 (encoding a PC4-homologous co-activator), in SSU71 (encoding yeast RAP74/TFIIF-alpha), or in SSU73 (encoding the 14.3-kDa subunit of pol II) [4] [6] [9]; XX FF functions in selecting the proper transcription start site [3]; XX IN T02137 PC4; human, Homo sapiens. IN T00798 Spt15p; yeast, Saccharomyces cerevisiae. IN T00794 TBP; human, Homo sapiens. XX BS R01016. XX DR EMBL: M81380; SCSUA7A. DR UniProtKB: P29055; TF2B_YEAST. XX RN [1]; RE0000039. RX PUBMED: 2917366. RA Buratowski S., Hahn S., Guarente L., Sharp P. A. RT Five Intermediate Complexes in Transcription Initiation by RNA Polymerase II RL Cell 56:549-561 (1989). RN [2]; RE0005534. RX PUBMED: 2187859. RA Amaya Y., Nakano A., Ito K., Mori M. RT Isolation of a yeast gene, SRH1, that encodes a homologue of the 54K subunit of mammalian signal recognition particle RL J. Biochem. 107:457-463 (1990). RN [3]; RE0005692. RX PUBMED: 1547497. RA Pinto I., Ware D. E., Hampsey M. RT The yeast SUA7 gene encodes a homolog of human transcription factor TFIIB and is required for normal start site selection in vivo RL Cell 68:977-988 (1992). RN [4]; RE0005704. RX PUBMED: 8617240. RA Knaus R., Pollock R., Guarente L. RT Yeast SUB1 is a suppressor of TFIIB mutations and has homology to the human co-activator PC4 RL EMBO J. 15:1933-1940 (1996). RN [5]; RE0005705. RX PUBMED: 8657130. RA Sun Z.-W., Hampsey M. RT Synthetic enhancement of a TFIIB defect by a mutation in SSU72, an essential yeast gene encoding a novel protein that affects transcription start site selection in vivo RL Mol. Cell. Biol. 16:1557-1566 (1996). RN [6]; RE0005706. RX PUBMED: 7724527. RA Sun Z.-W., Hampsey M. RT Identification of the gene (SSU71/TFG1) encoding the largest subunit of transcription factor TFIIF as a suppressor of a TFIIB mutation in Saccharomyces cerevisiae RL Proc. Natl. Acad. Sci. USA 92:3127-3131 (1995). RN [7]; RE0005707. RX PUBMED: 1454810. RA Tschochner H., Sayre M. H., Flanagan P. M., Feaver W. J., Kornberg R. D. RT Yeast RNA polymerase II initiation factor e: Isolation and identification as the functional counterpart of human transcription factor IIB RL Proc. Natl. Acad. Sci. USA 89:11292-11296 (1992). RN [8]; RE0005708. RX PUBMED: 7982976. RA Pinto I., Wu W.-H., Na J. G., Hampsey M. RT Characterization of sua7 mutations defines a domain of TFIIB involved in transcription start site selection in yeast RL J. Biol. Chem. 269:30569-30573 (1994). RN [9]; RE0005709. RX PUBMED: 8692696. RA Sun Z.-W., Tessmer A., Hampsey M. RT Functional interaction between TFIIB and the Rpb9 (Ssu73) subunit of RNA polymerase II in Saccharomyces cerevisiae RL Nucleic Acids Res. 24:2560-2566 (1996). XX //