TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00894 XX ID T00894 XX DT 15.10.1992 (created); ewi. DT 23.05.1996 (updated); rkn. CO Copyright (C), QIAGEN. XX FA Vmw65 XX SY alpha-TIF; ICP25; Vmw65; VP16. XX OS HSV-1, herpes simplex virus type 1 OC viridae; ds-DNA enveloped viruses; herpesviridae; alphaherpesviridae XX SZ 490 AA; 54.3 kDa (cDNA) (calc.), 64 kDa (SDS) XX SQ MDLLVDELFADMNADGASPPPPRPAGGPKNTPAAPPLYATGRLSQAQLMPSPPMPVPPAA SQ LFNRLLDDLGFSAGPALCTMLDTWNEDLFSALPTNADLYRECKFLSTLPSDVVEWGDAYV SQ PERTQIDIRAHGDVAFPTLPATRDGLGLYYEALSRFFHAELRAREESYRTVLANFCSALY SQ RYLRASVRQLHRQAHMRGRDRDLGEMLRATIADRYYRETARLARVLFLHLYLFLTREILW SQ AAYAEQMMRPDLFDCLCCDLESWRQLAGLFQPFMFVNGALTVRGVPIEARRLRELNHIRE SQ HLNLPLVRSAATEEPGAPLTTPPTLHGNQARASGYFMVLIRAKLDSYSSFTTSPSEAVMR SQ EHAYSRARTKNNYGSTIEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSL SQ GDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFT SQ DALGIDEYGG XX SC Swiss-Prot#P06492 XX FT 26 387 PF02232; Alpha trans-inducing protein (Alpha-TIF). XX FF induces transcription of immediate-early viral (HSV) genes; XX IN T02144 Ada2p; yeast, Saccharomyces cerevisiae. IN T00118 HCF1-isoform1; human, Homo sapiens. IN T00641 POU2F1-isoform1; human, Homo sapiens. IN T00642 POU2F1; clawed frog, Xenopus laevis. IN T00643 POU2F1; rat, Rattus norvegicus. IN T00959 POU2F1; monkey, Cercopithecus aethiops. IN T01031 POU2F1; chick, Gallus gallus. IN T01157 POU2F1; gibbon ape, Hylobates lar. IN T00644 POU2F1a; mouse, Mus musculus. IN T01862 POU2F1b; mouse, Mus musculus. IN T01863 POU2F1c; mouse, Mus musculus. IN T00798 Spt15p; yeast, Saccharomyces cerevisiae. IN T02113 TAFII31; human, Homo sapiens. IN T02125 TAFII40; fruit fly, Drosophila melanogaster. IN T00794 TBP; human, Homo sapiens. IN T00795 TBP; fission yeast, Schizosaccharomyces pombe. IN T00796 TBP; mouse, Mus musculus. IN T00797 TBP; fruit fly, Drosophila melanogaster. IN T00818 TFIIB; human, Homo sapiens. IN T02262 TFIIH; human, Homo sapiens. XX BS R00810. BS R01917. BS R00812. BS R02733. BS R00814. BS R00815. BS R00820. BS R00824. XX DR TRANSPATH: MO000045998. DR EMBL: X03141; HEHSV165. DR EMBL: X14112; HE1CG. DR UniProtKB: P06492; ATIN_HSV11. XX RN [1]; RE0000087. RX PUBMED: 2830986. RA Preston C. M., Frame M. C., Campbell M. E. M. RT A Complex formed between Cell Components and an HSV Structural Polypeptide Binds to a Viral Immediate Early Gene Regulatory DNA Sequence RL Cell 52:425-434 (1988). RN [2]; RE0001180. RX PUBMED: 1645782. RA Spector D., Purves F., Roizman B. RT Role of alpha-transducing factor (VP16) in the induction of alpha genes within the context of viral genomes RL J. Virol. 65:3504-3513 (1991). RN [3]; RE0001881. RX PUBMED: 1646402. RA Ingles C. J., Shales M., Cress W. D., Triezenberg S. J., Greenblatt J. RT Reduced binding of TFIID to transcriptionally compromised mutants of VP16 RL Nature 351:588-590 (1991). RN [4]; RE0001882. RX PUBMED: 2193231. RA Stringer K. F., Ingles C. J., Greenblatt J. RT Direct and selective binding of an acidic transcriptional activation domain to the TATA-box factor TFIID RL Nature 345:783-786 (1990). RN [5]; RE0002148. RX PUBMED: 2175881. RA Katan M., Haigh A., Verrijzer C. P., van der Vliet P. C., O'Hare P. RT Characterization of a cellular factor which interacts functionally with Oct-1 in the assembly of a multicomponent transcription complex RL Nucleic Acids Res. 18:6871-6880 (1990). RN [6]; RE0002311. RX PUBMED: 3025864. RA Kristie T. M., Roizman B. RT Host cell proteins bind to the cis-acting site required for virion-mediated induction of herpes simplex virus 1 alpha genes RL Proc. Natl. Acad. Sci. USA 84:71-75 (1987). RN [7]; RE0002312. RX PUBMED: 2823252. RA McKnight J. L. C., Kristie T. M., Roizman B. RT Binding of the virion protein mediating alpha gene induction in herpes simplex virus 1-infected cells to its cis site requires cellular proteins RL Proc. Natl. Acad. Sci. USA 84:7061-7065 (1987). XX //