TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00644 XX ID T00644 XX DT 15.10.1992 (created); ewi. DT 22.11.2005 (updated); oke. CO Copyright (C), QIAGEN. XX FA POU2F1a XX SY alpha-H1; IgNF-A; NF-A; NF-A1; NF-III; OBP100; Oct-1; oct-B1A; oct-B1B; octamer-binding factor; OTF-1; TRF. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009187 Pou2f1. XX CL C0007; POU. XX SZ 770 AA; 79.5 kDa (cDNA) (calc.), 90-100 kDa (SDS) XX SQ MNNPSETNKSSMESEDASTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS SQ LQAAAQSLNVQSKSSEESGDSQQSSQPSSQPPSVQSAIPQTQLMLAGGQITGLTLTPAQQ SQ QLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQL SQ QQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQP SQ QPSITLTSQPTTPTRTIAAASVQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRR SQ IKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSD SQ STASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLN SQ MEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPASLVATTPSLVTSSTATTLT SQ VNPVLPLTSAAVTNLSLTDQDLRRGCSWEVLRSLPDRVTTTAGTTDSTSNNNTATVISTA SQ PPASSAVTSPSLSPSPSASASTSEASSASETNTTQTTSTPLPSPLGASQVMVTTPGLQTA SQ AAALQGAGQLPANASLAAMAAAAGLSPGLMAPSQFAAGGALLSLSPGTLGSALSPALMSN SQ STLATIQALASSGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLV SQ SAAAASTGNSAPTASLHASSTSTESIQSSLFTVASASGPASTTTAASKAQ XX SC Swiss-Prot#P25425-1 XX FT 281 355 PF00157; Pou domain - N-terminal to homeobox domain. FT 281 355 SM00352; pou. FT 380 440 PS50071; HOMEOBOX_2. FT 380 442 PS50550; POU_HOMEODOMAIN. FT 382 444 SM00389; HOX_1. FT 383 439 PF00046; Homeobox domain. FT 454 731 PF00478; IMP dehydrogenase / GMP reductase domain. FT 499 522 missing in Oct-1B and Oct-1C [14]. FT 717 770 replaced by 693-701 in Oct-1C [14]. XX SF at least 3 splice variants are encoded by the murine oct-1 gene [14]; SF compared to the human homolog, mouse Oct-1 exhibits four AA exchanges within helix 1 and 2 making its sequence more similar to (human) Oct-2 and thus causing a much weaker interaction with VP16 [14] [16]; SF homeo domain essential for GR interaction [11]; XX CP ubiquitous [3]. XX FF DNA-binding is reduced by GR in a ligand-dependent manner [11]; XX IN T01030 CCF; human, Homo sapiens. IN T00337 GR-alpha; human, Homo sapiens. IN T01920 GR-beta; human, Homo sapiens. IN T00333 GR; rat, Rattus norvegicus. IN T02142 OCA-B; mouse, Mus musculus. IN T00649 Oct-2; cat, Felis silvestris catus. IN T00650 Oct-2; rat, Rattus rattus. IN T00894 Vmw65; HSV-1, herpes simplex virus type 1. XX MX M00135 V$OCT1_01. MX M00136 V$OCT1_02. MX M00137 V$OCT1_03. MX M00138 V$OCT1_04. MX M00161 V$OCT1_05. MX M00162 V$OCT1_06. MX M00248 V$OCT1_07. MX M01354 V$OCT1_08. MX M00342 V$OCT1_B. MX M00930 V$OCT1_Q5_01. MX M00195 V$OCT1_Q6. MX M00210 V$OCT_C. MX M00795 V$OCT_Q6. MX M07059 V$POU2F1_Q4_01. MX M03561 V$POU2F1_Q6. XX BS R16342. BS R16343. BS R03333. BS R03334. BS R03335. BS R16335. BS R16349. BS R16350. BS R16351. BS R16352. BS R16208. BS R16346. BS R16344. BS R16340. BS R16341. BS R15439. BS R00810. BS R02824. BS R13419. BS R13422. BS R13423. BS R13427. BS R13428. BS R00303. BS R00304. BS R00305. BS R00306. BS R15140. BS R00864. BS R00870. BS R00872. BS R01884. BS R01885. BS R01886. BS R16347. BS R16348. BS R16334. BS R16355. BS R16357. BS R15132. BS R02225. BS R04594. BS R04595. BS R04602. BS R04708. BS R04726. BS R04727. BS R04728. BS R16177. BS R16178. BS R16180. BS R16181. BS R01933. XX DR TRANSPATH: MO000046030. DR EMBL: X56230; MMOCT1R. DR EMBL: X68362; MMOCT1A. DR EMBL: X70325; MMOCT1AA. DR UniProtKB: P25425-1; XX RN [1]; RE0000088. RX PUBMED: 3091258. RA Sen R., Baltimore D. RT Multiple nuclear factors interact with the immunoglobulin enhancer sequences RL Cell 46:705-716 (1986). RN [2]; RE0000405. RX PUBMED: 2826127. RA Rosales R., Vigneron M., Macchi M., Davidson I., Xiao J. H., Chambon P. RT In vitro binding of cell-specific and ubiquitous nuclear proteins to the octamer motif of the SV40 enhancer and related motifs present in other promoters and enhancers RL EMBO J. 6:3015-3025 (1987). RN [3]; RE0000423. RX PUBMED: 2573523. RA Schoeler H. R., Hatzopoulos A. K., Balling R., Suzuki N., Gruss P. RT A family of octamer-specific proteins present during mouse embryogenesis: evidence for germline-specific expression of an Oct factor RL EMBO J. 8:2543-2550 (1989). RN [4]; RE0000424. RX PUBMED: 2573524. RA Schoeler H. R., Balling R., Hatzopoulos A. K., Suzuki N., Gruss P. RT Octamer binding proteins confer transcriptional activity in early mouse embryogenesis RL EMBO J. 8:2551-2557 (1989). RN [5]; RE0000891. RX PUBMED: 2498322. RA Takimoto M., Quinn J. P., Farina A. R., Staudt L. M., Levens D. RT fos/jun and Octamer-binding Protein Interact with a Common Site in a Negative Element of the Human c-myc Gene RL J. Biol. Chem. 264:8982-8999 (1989). RN [6]; RE0001367. RX PUBMED: 2113179. RA Nelms K., van Ness B. RT Identification of an Octamer-Binding Site in the Human Kappa Light-Chain Enhancer RL Mol. Cell. Biol. 10:3843-3846 (1990). RN [7]; RE0001800. RX PUBMED: 3095662. RA Staudt L. M., Singh H., Sen R., Wirth T., Sharp P. A., Baltimore D. RT A lymphoid-specific protein binding to the octamer motif of immunoglobulin genes RL Nature 323:640-643 (1986). RN [8]; RE0002315. RX PUBMED: 3259319. RA Hanke J. H., Landolfi N. F., Tucker P. W., Capra J. D. RT Identification of murine nuclear proteins that bind to the conserved octamer sequence of the immunoglobulin promoter region RL Proc. Natl. Acad. Sci. USA 85:3560-3564 (1988). RN [9]; RE0002378. RX PUBMED: 2508087. RA Hermanson G. G., Briskin M., Sigman D., Wall R. RT Immunoglobulin enhancer and promoter motifs 5' of the B29 B-cell-specific gene RL Proc. Natl. Acad. Sci. USA 86:7341-7345 (1989). RN [10]; RE0002740. RX PUBMED: 2357966. RA Schoeler H. R., Dressler G. R., Balling R., Rohdewohld H., Gruss P. RT Oct-4: a germline-specific transcription factor mapping to the mouse t-complex RL EMBO J. 9:2185-2195 (1990). RN [11]; RE0002981. RX PUBMED: 1406672. RA Kutoh E., Stroemstedt P.-E., Poellinger L. RT Functional interference between the ubiquitous and constitutive octamer transcription factor 1 (OTF-1) and the glucocorticoid receptor by direct protein-protein interaction involving the homeo subdomain of OTF-1 RL Mol. Cell. Biol. 12:4960-4969 (1992). RN [12]; RE0004178. RX PUBMED: 1561098. RA Stepchenko A. G. RT The nucleotide sequence of mouse OCT-1 cDNA RL Nucleic Acids Res. 20:1419 (1992). RN [13]; RE0004184. RX PUBMED: 7622033. RA Herr W., Cleary M. A. RT The POU domain: versatility in tanscriptional regulation by a flexible two-in-one DNA-binding domain RL Genes Dev. 9:1679-1693 (1995). RN [14]; RE0004185. RX PUBMED: 8441632. RA Suzuki N., Peter W., Ciesiolka T., Gruss P., Schoeler H. R. RT Mouse Oct-1 contains a composite homeodomain of human Oct-1 and Oct-2 RL Nucleic Acids Res. 21:245-252 (1993). RN [15]; RE0004186. RX PUBMED: 1970171. RA Goldsborough A., Ashworth A., Willison K. R. RT Cloning and sequencing of POU-boxes expressed in mouse testis RL Nucleic Acids Res. 18:1634-1634 (1990). RN [16]; RE0004213. RX PUBMED: 8422989. RA Cleary M. A., Stern S., Tanaka M., Herr W. RT Differential positive control by Oct-1 and Oct-2: activation of a transcriptionally silent motif through Oct-1 and VP16 corecruitment RL Genes Dev. 7:72-83 (1993). XX //