AC T01920
XX
ID T01920
XX
DT 04.09.1996 (created); ewi.
DT 27.06.2011 (updated); spa.
CO Copyright (C), QIAGEN.
XX
FA GR-beta
XX
SY Beta-A; glucocorticoid receptor beta; GR beta; NR3C1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G000268 NR3C1; HGNC: NR3C1.
XX
CL C0002; CC (rec); 2.1.1.1.1.2.
XX
SZ 742 AA; 81.5 kDa (cDNA) (calc.), 88-94 kDa (SDS)
XX
SQ MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
SQ LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
SQ LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
SQ VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SQ SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
SQ YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SQ SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
SQ CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
SQ CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
SQ PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
SQ MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
SQ EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
SQ LLDSMHENVMWLKPESTSHTLI
XX
SC translated from EMBL #X03348
XX
FT 26 401 
PF02155; Glucocorticoid receptor.
FT 78 262 
trans-activating domain (tau1) [20].
FT 261 595 
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 418 489 
SM00399; c4gold.
FT 418 493 
PS51030; NUCLEAR_REC_DBD_2.
FT 419 494 
PF00105; Zinc finger, C4 type (two domains).
FT 421 486 
region C, DNA-binding domain (DBD) [19].
FT 526 556 
trans-activating domain (tau2) [21].
FT 565 729 
SM00430; holi.
FT 568 735 
PF00104; Ligand-binding domain of nuclear hormon.
XX
SF 2 splice variants alpha T00337 (777 AA) and beta T01920, differing in their C-termini [8];
SF the first zinc finger binds specifically to the GRE, the second enhances the affinity [11];
SF AGRND within the second finger mediates homodimerization and contributes to the differential DNA-binding specificity against other nuclear receptors [14];
SF G->E-variant (after 3rd Cys of the zinc finger region) recognizes GRE as well as ERE;
SF AGRND -> KYEGK (between 1st Cys doublet of the 2nd zinc finger): conversion to a TRE-binding receptor;
SF cooperative binding to a double GRE through tau1 domain;
XX
FF when coexpressed with alpha isoform T00337 it inhibits hormone-induced, hGRalpha-mediated stimulation of gene expression: thus potentially functions as a dominant negative inhibitor of hGRalpha activity [23];
FF does not bind the glucocorticoid agonist dexamethasone nor the glucocorticoid antagonist RU38486 in vivo [23];
FF in contrast to alpha isoform T00337 located primarily in the nucleus independent of hormone administration [23];
FF transcriptionally inactive in the absence alpha isoform T00337 (on a glucocorticoid-responsive enhancer) [23];
XX
IN T00029 AP-1; human, Homo sapiens.
IN T00123 c-Fos; human, Homo sapiens.
IN T00133 c-Jun; human, Homo sapiens.
IN T00990 FKBP59; human, Homo sapiens.
IN T00337 GR-alpha; human, Homo sapiens.
IN T00993 hsp56; human, Homo sapiens.
IN T00992 Hsp90; human, Homo sapiens.
IN T01466 POU2F1; Chinese hamster (Gray hamster), Cricetulus griseus.
IN T00644 POU2F1a; mouse, Mus musculus.
XX
MX M00205 V$GRE_C.
MX M07355 V$GR_Q4.
MX M00192 V$GR_Q6.
MX M00921 V$GR_Q6_01.
MX M00960 V$PR_Q2.
XX
BS R03199.
BS R03526.
BS R03530.
BS R03531.
BS R03561.
BS R03562.
BS R00973.
BS R00974.
BS R00975.
BS R02163.
BS R12350.
BS R00591.
BS R00593.
BS R00595.
BS R03551.
BS R03552.
BS R03555.
BS R03556.
BS R19531.
BS R01480.
BS R01481.
XX
DR TRANSPATH: MO000026033.
DR EMBL: M11050;
DR EMBL: M73816;
DR EMBL: X03348;
DR UniProtKB: P04150-2;
XX
RN [1]; RE0000168.
RX PUBMED: 2169351.
RA Jonat C., Rahmsdorf H. J., Park K.-K., Cato A. C. B., Gebel S., Ponta H., Herrlich P.
RT Antitumor promotion and antiinflammation: Down-modulation of AP-1 (Fos/Jun) activity by glucocorticoid hormone
RL Cell 62:1189-1204 (1990).
RN [2]; RE0000247.
RX PUBMED: 2169353.
RA Schuele R., Rangarajan P., Kliewer S., Ransone L. J., Bolado J., Yang N., Verma I. M., Evans R. M.
RT Functional antagonism between oncoprotein c-Jun and the glucocorticoid receptor
RL Cell 62:1217-1226 (1990).
RN [3]; RE0000271.
RX PUBMED: 2500251.
RA Umesono K., Evans R. M.
RT Determinants of target gene specificity for steroid/thyroid hormone receptors
RL Cell 57:1139-1146 (1989).
RN [4]; RE0000998.
RX PUBMED: 2037566.
RA Alksnis M., Barkhem T., Stroemstedt P.-E., Ahola H., Kutoh E., Gustafsson J.-A., Poellinger L., Nilsson S.
RT High level expression of functional full length and truncated glucocorticoid receptor in chinese hamster ovary cells
RL J. Biol. Chem. 266:10078-10085 (1991).
RN [5]; RE0001041.
RX PUBMED: 2071584.
RA Nazareth L. V., Harbour D. V., Thompson E. B.
RT Mapping the human glucocorticoid receptor for leukemic cell death
RL J. Biol. Chem. 266:12976-12980 (1991).
RN [6]; RE0001752.
RX PUBMED: 2172797.
RA Forman B. M., Samuels H. H.
RT Interactions among a subfamily of nuclear hormone receptors: the regulatory zipper model
RL Mol. Endocrinol. 4:1293-1301 (1990).
RN [7]; RE0001830.
RX PUBMED: 3841189.
RA Weinberger C., Hollenberg S. M., Rosenfeld G. M., Evans R. M.
RT Domain structure of human glucocorticoid receptor and its relationship to the v-erb-A oncogene product
RL Nature 318:670-672 (1985).
RN [8]; RE0001831.
RX PUBMED: 2867473.
RA Hollenberg S. M., Weinberger C., Ong E. S., Cerelli G., Oro A., Lebo R., Thompson E. B., Rosenfeld G. M., Evans R. M.
RT Primary structure and expression of a functional human glucocorticoid receptor cDNA
RL Nature 318:635-641 (1985).
RN [9]; RE0002533.
RX PUBMED: 1924286.
RA Wright A. P. H., Gustafsson J.-A.
RT Mechanism of synergistic transcriptional transactivation by the human glucocorticoid receptor
RL Proc. Natl. Acad. Sci. USA 88:8283-8287 (1991).
RN [10]; RE0002597.
RX PUBMED: 2838908.
RA Akerblom I., Slater E. P., Beato M., Baxter J. D., Mellon P. L.
RT Negative regulation by glucocorticoids through interference with a cAMP responsive enhancer
RL Science 241:350-353 (1988).
RN [11]; RE0002694.
RX PUBMED: 2115209.
RA Haerd T., Kelenbach E., Boelens R., Maler B. A., Dahlmann K., Freedman L. P., Carlstedt-Duke J., Yamamoto K. R., Gustafsson J.-A., Kaptein R.
RT Solution structure of the glucocorticoid receptor DNA-binding domain
RL Science 249:157-160 (1990).
RN [12]; RE0002702.
RX PUBMED: 1376003.
RA Ku Tai P.-K., Albers M. W., Chang H., Faber L. E., Schreiber S. L.
RT Association of a 59-kilodalton immunophilin with the glucocorticoid receptor complex
RL Science 256:1315-1318 (1992).
RN [13]; RE0002813.
RX PUBMED: 2266108.
RA Sanchez E. R.
RT Hsp56: A novel heat shock protein associated with untransformed steroid receptor complexes
RL J. Biol. Chem. 265:22067-22070 (1990).
RN [14]; RE0002814.
RX PUBMED: 1993683.
RA Dahlman-Wright K., Wright A., Gustafsson J.-A., Carlstedt-Duke J.
RT Interaction of the glucocorticoid receptor DNA-binding domain with DNA as a dimer is mediated by a short segment of five amino acids
RL J. Biol. Chem. 266:3107-3112 (1991).
RN [15]; RE0002818.
RX PUBMED: 1708098.
RA Chatterjee V. K. K., Madison L. D., Mayo S., Jameson J. L.
RT Repression of the human glycoprotein hormone Alpha-subunit gene by glucocorticoids: Evidence for receptor interactions with limiting transcriptional activators
RL Mol. Endocrinol. 5:100-110 (1991).
RN [16]; RE0002981.
RX PUBMED: 1406672.
RA Kutoh E., Stroemstedt P.-E., Poellinger L.
RT Functional interference between the ubiquitous and constitutive octamer transcription factor 1 (OTF-1) and the glucocorticoid receptor by direct protein-protein interaction involving the homeo subdomain of OTF-1
RL Mol. Cell. Biol. 12:4960-4969 (1992).
RN [17]; RE0003705.
RX PUBMED: 1279700.
RA Peattie D. A., Harding M. W., Fleming M. A., DeCenzo M. T., Lippke J. A., Livingston D. J., Benasutti M.
RT Expression and characterization of the human FKBP52, an immunophilin that associates with the 90-kDa heat shock protein and is a component of steroid receptor proteins
RL Proc. Natl. Acad. Sci. USA 89:10974-10978 (1992).
RN [18]; RE0003707.
RX PUBMED: 3829127.
RA Hollenberg S. M., Giguere V., Segul P., Evans R. M.
RT Colocalization of DNA-binding and transcriptional activation functions in the human glucocorticoid receptor
RL Cell 49:39-46 (1987).
RN [19]; RE0003708.
RX PUBMED: 3742595.
RA Giguere V., Hollenberg S. M., Rosenfeld M. G., Evans R. M.
RT Functional domains of the human glucocorticoid receptor
RL Cell 46:645-652 (1986).
RN [20]; RE0003709.
RX PUBMED: 3144438.
RA Oro A. E., Hollenberg S. M., Evans R. M.
RT Transcriptional inhibition by a glucocorticoid receptor-beta-galactosidase fusion protein
RL Cell 55:1109-1114 (1988).
RN [21]; RE0003710.
RX PUBMED: 3191531.
RA Hollenberg S. M., Evans R. M.
RT Multiple and cooperative trans-activation domains of the human glucocorticoid receptor
RL Cell 55:899-906 (1988).
RN [22]; RE0003712.
RX PUBMED: 2463158.
RA Straehle U., Schmid W., Schuetz G.
RT Synergistic action of the glucocorticoid receptor with transcription factors
RL EMBO J. 7:3389-3395 (1988).
RN [23]; RE0017678.
RX PUBMED: 8621628.
RA Oakley R. H., Sar M., Cidlowski J. A.
RT The human glucocorticoid receptor beta isoform. Expression, biochemical properties, and putative function
RL J. Biol. Chem. 271:9550-9559 (1996).
RN [24]; RE0047646.
RX PUBMED: 15289446.
RA Dschietzig T., Bartsch C., Stangl V., Baumann G., Stangl K.
RT Identification of the pregnancy hormone relaxin as glucocorticoid receptor agonist.
RL FASEB J. 18:1536-1538 (2004).
XX
//