TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00337 XX ID T00337 XX DT 15.10.1992 (created); ewi. DT 31.12.2014 (updated); ros. CO Copyright (C), QIAGEN. XX FA GR-alpha XX SY Alpha-A; glucocorticoid receptor; GR; GR alpha; NR3C1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G000268 NR3C1; HGNC: NR3C1. XX CL C0002; CC (rec); 2.1.1.1.1.1. XX SZ 777 AA; 85.7 kDa (cDNA) (calc.), 88-94 kDa (SDS) XX SQ MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR SQ LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK SQ LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN SQ VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN SQ SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV SQ YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SQ SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL SQ CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK SQ CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE SQ PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW SQ MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY SQ EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK SQ LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK XX SC Swiss-Prot#P04150-1 XX FT 26 401 PF02155; Glucocorticoid receptor. FT 78 262 trans-activating domain (tau1) [20]. FT 187 285 amino-terminal activation function AF-1 [24]. FT 187 285 functional cooperation with STAT5 [24]. FT 261 595 PF00478; IMP dehydrogenase / GMP reductase domai. FT 418 489 SM00399; c4gold. FT 418 493 PS51030; NUCLEAR_REC_DBD_2. FT 419 494 PF00105; Zinc finger, C4 type (two domains). FT 421 486 region C, DNA-binding domain (DBD) [19]. FT 482 777 C-terminal ligand binding domain, LBD [24]. FT 526 556 trans-activating domain (tau2) [21]. FT 565 729 SM00430; holi. FT 568 752 PF00104; Ligand-binding domain of nuclear hormon. FT 748 762 AF-2 domain (transactivation activity) [23]. XX SF 2 splice variants alpha T00337 and beta T01920 (742 AA), differing in their C-termini [8]; SF the first zinc finger binds specifically to the GRE, the second enhances the affinity [11]; SF AGRND within the second finger mediates homodimerization and contributes to the differential DNA-binding specificity against other nuclear receptors [14]; SF G->E-variant (after 3rd Cys of the zinc finger region) recognizes GRE as well as ERE; SF AGRND -> KYEGK (between 1st Cys doublet of the 2nd zinc finger): conversion to a TRE-binding receptor; SF cooperative binding to a double GRE through tau1 domain; XX FF activator or repressor in response to glucocorticoid hormones [10]; FF binds hormone, translocates into the nucleus, and activates transcription of hormone-sensitive gene in contrast to beta isoform T01920 which does not activate known hormone-sensitive genes [8]; FF cooperating with other transcription factors, it may act through composite elements [15] [22]; FF can be inhibited by physical interaction with c-Jun or c-Fos [2] [1]; FF represses Oct-1 DNA binding [16]; FF leukemic cell lethality through DBD (1st zinc finger and 1/2 of second) [5]; FF often provides glucocorticoid-dependent gene activation acting as a co-activator rather than a DNA-binding factor, may function as a co-activator for STAT5 [24]; XX IN T00029 AP-1; human, Homo sapiens. IN T00123 c-Fos; human, Homo sapiens. IN T00133 c-Jun; human, Homo sapiens. IN T06596 C/EBPbeta-LIP; human, Homo sapiens. IN T08300 ER-alpha-L; human, Homo sapiens. IN T00990 FKBP59; human, Homo sapiens. IN T00337 GR-alpha; human, Homo sapiens. IN T01920 GR-beta; human, Homo sapiens. IN T00993 hsp56; human, Homo sapiens. IN T00992 Hsp90; human, Homo sapiens. IN T01466 POU2F1; Chinese hamster (Gray hamster), Cricetulus griseus. IN T00644 POU2F1a; mouse, Mus musculus. IN T30113 Trx1; human, Homo sapiens. XX MX M00205 V$GRE_C. MX M07355 V$GR_Q4. MX M00192 V$GR_Q6. MX M00921 V$GR_Q6_01. MX M01836 V$GR_Q6_02. MX M02219 V$NR3C1_01. MX M00960 V$PR_Q2. XX BS R03199. BS R03526. BS R03530. BS R03531. BS R03561. BS R03562. BS R00973. BS R00974. BS R00975. BS R02163. BS R12350. BS R35593. BS R38869. BS R38870. BS R00591. BS R00593. BS R00595. BS R12328. BS R12329. BS R12330. BS R73928. BS R73929. BS R03551. BS R03552. BS R03555. BS R03556. BS R39686. BS R01480. BS R01481. BS R26402. BS R26403. BS R26405. XX DR TRANSPATH: MO000019614. DR TRANSCOMPEL: C00130. DR PATHODB: MT010635. DR PATHODB: MT010647. DR PATHODB: MT010651. DR PATHODB: MT010652. DR PATHODB: MT010653. DR PATHODB: MT010654. DR PATHODB: MT010655. DR PATHODB: MT010658. DR PATHODB: MT010660. DR PATHODB: MT010677. DR PATHODB: MT010678. DR PATHODB: MT010679. DR EMBL: M10901; HSGCRA. DR EMBL: M73050; HSGRA1. DR EMBL: X03225; HSGCRAR. DR UniProtKB: P04150-1; XX RN [1]; RE0000168. RX PUBMED: 2169351. RA Jonat C., Rahmsdorf H. J., Park K.-K., Cato A. C. B., Gebel S., Ponta H., Herrlich P. RT Antitumor promotion and antiinflammation: Down-modulation of AP-1 (Fos/Jun) activity by glucocorticoid hormone RL Cell 62:1189-1204 (1990). RN [2]; RE0000247. RX PUBMED: 2169353. RA Schuele R., Rangarajan P., Kliewer S., Ransone L. J., Bolado J., Yang N., Verma I. M., Evans R. M. RT Functional antagonism between oncoprotein c-Jun and the glucocorticoid receptor RL Cell 62:1217-1226 (1990). RN [3]; RE0000271. RX PUBMED: 2500251. RA Umesono K., Evans R. M. RT Determinants of target gene specificity for steroid/thyroid hormone receptors RL Cell 57:1139-1146 (1989). RN [4]; RE0000998. RX PUBMED: 2037566. RA Alksnis M., Barkhem T., Stroemstedt P.-E., Ahola H., Kutoh E., Gustafsson J.-A., Poellinger L., Nilsson S. RT High level expression of functional full length and truncated glucocorticoid receptor in chinese hamster ovary cells RL J. Biol. Chem. 266:10078-10085 (1991). RN [5]; RE0001041. RX PUBMED: 2071584. RA Nazareth L. V., Harbour D. V., Thompson E. B. RT Mapping the human glucocorticoid receptor for leukemic cell death RL J. Biol. Chem. 266:12976-12980 (1991). RN [6]; RE0001752. RX PUBMED: 2172797. RA Forman B. M., Samuels H. H. RT Interactions among a subfamily of nuclear hormone receptors: the regulatory zipper model RL Mol. Endocrinol. 4:1293-1301 (1990). RN [7]; RE0001830. RX PUBMED: 3841189. RA Weinberger C., Hollenberg S. M., Rosenfeld G. M., Evans R. M. RT Domain structure of human glucocorticoid receptor and its relationship to the v-erb-A oncogene product RL Nature 318:670-672 (1985). RN [8]; RE0001831. RX PUBMED: 2867473. RA Hollenberg S. M., Weinberger C., Ong E. S., Cerelli G., Oro A., Lebo R., Thompson E. B., Rosenfeld G. M., Evans R. M. RT Primary structure and expression of a functional human glucocorticoid receptor cDNA RL Nature 318:635-641 (1985). RN [9]; RE0002533. RX PUBMED: 1924286. RA Wright A. P. H., Gustafsson J.-A. RT Mechanism of synergistic transcriptional transactivation by the human glucocorticoid receptor RL Proc. Natl. Acad. Sci. USA 88:8283-8287 (1991). RN [10]; RE0002597. RX PUBMED: 2838908. RA Akerblom I., Slater E. P., Beato M., Baxter J. D., Mellon P. L. RT Negative regulation by glucocorticoids through interference with a cAMP responsive enhancer RL Science 241:350-353 (1988). RN [11]; RE0002694. RX PUBMED: 2115209. RA Haerd T., Kelenbach E., Boelens R., Maler B. A., Dahlmann K., Freedman L. P., Carlstedt-Duke J., Yamamoto K. R., Gustafsson J.-A., Kaptein R. RT Solution structure of the glucocorticoid receptor DNA-binding domain RL Science 249:157-160 (1990). RN [12]; RE0002702. RX PUBMED: 1376003. RA Ku Tai P.-K., Albers M. W., Chang H., Faber L. E., Schreiber S. L. RT Association of a 59-kilodalton immunophilin with the glucocorticoid receptor complex RL Science 256:1315-1318 (1992). RN [13]; RE0002813. RX PUBMED: 2266108. RA Sanchez E. R. RT Hsp56: A novel heat shock protein associated with untransformed steroid receptor complexes RL J. Biol. Chem. 265:22067-22070 (1990). RN [14]; RE0002814. RX PUBMED: 1993683. RA Dahlman-Wright K., Wright A., Gustafsson J.-A., Carlstedt-Duke J. RT Interaction of the glucocorticoid receptor DNA-binding domain with DNA as a dimer is mediated by a short segment of five amino acids RL J. Biol. Chem. 266:3107-3112 (1991). RN [15]; RE0002818. RX PUBMED: 1708098. RA Chatterjee V. K. K., Madison L. D., Mayo S., Jameson J. L. RT Repression of the human glycoprotein hormone Alpha-subunit gene by glucocorticoids: Evidence for receptor interactions with limiting transcriptional activators RL Mol. Endocrinol. 5:100-110 (1991). RN [16]; RE0002981. RX PUBMED: 1406672. RA Kutoh E., Stroemstedt P.-E., Poellinger L. RT Functional interference between the ubiquitous and constitutive octamer transcription factor 1 (OTF-1) and the glucocorticoid receptor by direct protein-protein interaction involving the homeo subdomain of OTF-1 RL Mol. Cell. Biol. 12:4960-4969 (1992). RN [17]; RE0003705. RX PUBMED: 1279700. RA Peattie D. A., Harding M. W., Fleming M. A., DeCenzo M. T., Lippke J. A., Livingston D. J., Benasutti M. RT Expression and characterization of the human FKBP52, an immunophilin that associates with the 90-kDa heat shock protein and is a component of steroid receptor proteins RL Proc. Natl. Acad. Sci. USA 89:10974-10978 (1992). RN [18]; RE0003707. RX PUBMED: 3829127. RA Hollenberg S. M., Giguere V., Segul P., Evans R. M. RT Colocalization of DNA-binding and transcriptional activation functions in the human glucocorticoid receptor RL Cell 49:39-46 (1987). RN [19]; RE0003708. RX PUBMED: 3742595. RA Giguere V., Hollenberg S. M., Rosenfeld M. G., Evans R. M. RT Functional domains of the human glucocorticoid receptor RL Cell 46:645-652 (1986). RN [20]; RE0003709. RX PUBMED: 3144438. RA Oro A. E., Hollenberg S. M., Evans R. M. RT Transcriptional inhibition by a glucocorticoid receptor-beta-galactosidase fusion protein RL Cell 55:1109-1114 (1988). RN [21]; RE0003710. RX PUBMED: 3191531. RA Hollenberg S. M., Evans R. M. RT Multiple and cooperative trans-activation domains of the human glucocorticoid receptor RL Cell 55:899-906 (1988). RN [22]; RE0003712. RX PUBMED: 2463158. RA Straehle U., Schmid W., Schuetz G. RT Synergistic action of the glucocorticoid receptor with transcription factors RL EMBO J. 7:3389-3395 (1988). RN [23]; RE0016449. RX PUBMED: 10428842. RA Hong H., Yang L., Stallcup M. R. RT Hormone-independent transcriptional activation and coactivator binding by novel orphan nuclear receptor ERR3 RL J. Biol. Chem. 274:22618-22626 (1999). RN [24]; RE0023558. RX PUBMED: 9343435. RA Stoecklin E., Wissler M., Moriggl R., Groner B. RT Specific DNA binding of Stat5, but not of glucocorticoid receptor, is required for their functional cooperation in the regulation of gene transcription. RL Mol. Cell. Biol. 17:6708-6716 (1997). RN [25]; RE0044354. RX PUBMED: 11773445. RA Christian M., Pohnke Y., Kempf R., Gellersen B., Brosens J. J. RT Functional association of PR and CCAAT/enhancer-binding protein beta isoforms: promoter-dependent cooperation between PR-B and liver-enriched inhibitory protein, or liver-enriched activatory protein and PR-A in human endometrial stromal cells RL Mol. Endocrinol. 16:141-54 (2002). RN [26]; RE0045857. RX PUBMED: 12897156. RA Kinyamu H. K., Archer T. K. RT Estrogen receptor-dependent proteasomal degradation of the glucocorticoid receptor is coupled to an increase in mdm2 protein expression RL Mol. Cell. Biol. 23:5867-81 (2003). RN [27]; RE0047646. RX PUBMED: 15289446. RA Dschietzig T., Bartsch C., Stangl V., Baumann G., Stangl K. RT Identification of the pregnancy hormone relaxin as glucocorticoid receptor agonist. RL FASEB J. 18:1536-1538 (2004). RN [28]; RE0047761. RX PUBMED: 15955845. RA Kino T., Tiulpakov A., Ichijo T., Chheng L., Kozasa T., Chrousos G. P. RT G protein beta interacts with the glucocorticoid receptor and suppresses its transcriptional activity in the nucleus. RL J. Cell Biol. 169:885-896 (2005). RN [29]; RE0047789. RX PUBMED: 12730237. RA Kino T., Souvatzoglou E., De Martino M. U., Tsopanomihalu M., Wan Y., Chrousos G. P. RT Protein 14-3-3sigma interacts with and favors cytoplasmic subcellular localization of the glucocorticoid receptor, acting as a negative regulator of the glucocorticoid signaling pathway. RL J. Biol. Chem. 278:25651-25656 (2003). RN [30]; RE0048506. RX PUBMED: 16914745. RA Wu Y., Kawate H., Ohnaka K., Nawata H., Takayanagi R. RT Nuclear compartmentalization of N-CoR and its interactions with steroid receptors. RL Mol. Cell. Biol. 26:6633-6655 (2006). XX //