
AC T08300
XX
ID T08300
XX
DT 24.11.2005 (created); ili.
DT 08.01.2015 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA ER-alpha-L
XX
SY ER; ER-alpha; ER-alpha long; estradiol receptor; estrogen receptor; estrogen receptor alpha; NR3A1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003925 ESR1; HGNC: ESR1.
XX
CL C0002; CC (rec); 2.1.1.2.1.1.
XX
SZ 595 AA; 66.2 kDa (cDNA) (calc.), 65 kDa (SDS) [37], 70 kDa (SDS) [1] [37] [1]
XX
SQ MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
SQ EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
SQ LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
SQ ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
SQ RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SQ SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
SQ AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
SQ MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
SQ KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
SQ LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
XX
SC Swiss-Prot#P03372-1
XX
FT 1 184
Modulating [36].
FT 1 181
PF02159; Oestrogen receptor.
FT 51 93
activating subdomain of AF-1 [2].
FT 51 149
activating function 1 (AF-1) [2].
FT 102 149
activating subdomain of AF-1 [2].
FT 182 253
SM00399; c4gold.
FT 182 257
PS51030; NUCLEAR_REC_DBD_2.
FT 183 258
PF00105; Zinc finger, C4 type (two domains).
FT 251 310
Hinge [36].
FT 295 579
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 348 518
SM00430; holi.
FT 351 543
PF00104; Ligand-binding domain of nuclear hormon.
FT 535 549
AF-2 domain (transactivation activity) [4].
XX
IN T25693 ADA3A; human, Homo sapiens.
IN T30262 alpha-actinin-4-isoform3; human, Homo sapiens.
IN T08796 ASC-2; human, Homo sapiens.
IN T25634 ASC-2; mouse, Mus musculus.
IN T08587 c-Jun; mouse, Mus musculus.
IN T09446 c-Jun; Mammalia.
IN T08664 C/EBPalpha; Mammalia.
IN T06595 C/EBPbeta-FL; human, Homo sapiens.
IN T09410 C/EBPbeta; Mammalia.
IN T08499 CBP; mouse, Mus musculus.
IN T08505 COUP-TF1; human, Homo sapiens.
IN T33929 DRIP205-isoform1; human, Homo sapiens.
IN T09637 ER-alpha; Mammalia.
IN T17427 ER-beta; mouse, Mus musculus.
IN T00337 GR-alpha; human, Homo sapiens.
IN T08475 GR-alpha; rat, Rattus norvegicus.
IN T06042 HDAC4; human, Homo sapiens.
IN T05017 HNF-4; rat, Rattus norvegicus.
IN T00992 Hsp90; human, Homo sapiens.
IN T04688 NCOR1; mouse, Mus musculus.
IN T10399 NF-kappaB1-p50; Mammalia.
IN T05299 NR1B1; human, Homo sapiens.
IN T14193 NR1B1; Mammalia.
IN T06148 p/CAF; human, Homo sapiens.
IN T23091 p300; Mammalia.
IN T27173 Rbp2-isoform1; human, Homo sapiens.
IN T27174 Rbp2; human, Homo sapiens.
IN T10397 RelA-p65; Mammalia.
IN T08433 RXR-alpha; human, Homo sapiens.
IN T08484 Sp1-isoform1; human, Homo sapiens.
IN T22416 SRC-1 (-Q); human, Homo sapiens.
IN T04632 SRC-1; human, Homo sapiens.
IN T21552 SRC-1; Mammalia.
IN T04640 SRC3; human, Homo sapiens.
IN T00838 T3R-alpha; human, Homo sapiens.
IN T00853 T3R-beta1; rat, Rattus norvegicus.
IN T08497 TIF2; human, Homo sapiens.
IN T13796 TLS; human, Homo sapiens.
IN T20366 ZNF131-isoform2; human, Homo sapiens.
XX
MX M07283 V$ERALPHA_Q4.
MX M03547 V$ERALPHA_Q6_01.
MX M03820 V$ERALPHA_Q6_02.
MX M00191 V$ER_Q6.
MX M00959 V$ER_Q6_02.
XX
BS R02150.
BS R14198.
BS R02715.
BS R03869.
BS R14257.
BS R01194.
BS R01195.
BS R01581.
BS R00144.
BS R14225.
BS R14226.
BS R14227.
BS R13265.
BS R14291.
BS R16116.
BS R14203.
BS R14211.
BS R14207.
BS R14209.
BS R24658.
BS R24660.
BS R14199.
BS R14200.
BS R18839.
BS R18840.
BS R14235.
BS R14286.
BS R14292.
BS R14228.
BS R03366.
BS R14197.
BS R03480.
BS R14237.
BS R10107.
BS R10108.
BS R01586.
BS R02665.
XX
DR TRANSPATH: MO000056595.
DR EMBL: M12674; HSERMCF.
DR UniProtKB: P03372-1;
DR PDB: 1hcp.
XX
RN [1]; RE0003780.
RX PUBMED: 3882696.
RA Lubahn D. B., McCarty jr K. S., McCarty sr K. S.
RT Electrophoretic characterization of purified bovine, porcine, murine, rat, and human uterine estrogen receptors
RL J. Biol. Chem. 260:2515-2526 (1985).
RN [2]; RE0003801.
RX PUBMED: 7721882.
RA Metzger D., Ali A., Bornet S.-M., Chambon P.
RT Characterization of the amino-terminal transcriptional activation function of the human estrogen receptor in animal and yeast cells
RL J. Biol. Chem. 270:9535-9542 (1995).
RN [3]; RE0004503.
RX PUBMED: 7651415.
RA Stein B., Yang M. X.
RT Repression of the interleukin-6 promoter by estrogen receptor is mediated by NF-kappaB and C/EBPbeta
RL Mol. Cell. Biol. 15:4971-4979 (1995).
RN [4]; RE0016449.
RX PUBMED: 10428842.
RA Hong H., Yang L., Stallcup M. R.
RT Hormone-independent transcriptional activation and coactivator binding by novel orphan nuclear receptor ERR3
RL J. Biol. Chem. 274:22618-22626 (1999).
RN [5]; RE0025974.
RX PUBMED: 9653119.
RA Yuan C. X., Ito M., Fondell J. D., Fu Z. Y., Roeder R. G.
RT The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion
RL Proc. Natl. Acad. Sci. USA 95:7939-44 (1998).
RN [6]; RE0030660.
RX PUBMED: 9817600.
RA Boruk M., Savory J. G., Hache R. J.
RT AF-2-dependent potentiation of CCAAT enhancer binding protein beta-mediated transcriptional activation by glucocorticoid receptor.
RL Mol. Endocrinol. 12:1749-63 (1998).
RN [7]; RE0041230.
RX PUBMED: 10747867.
RA Kobayashi Y., Kitamoto T., Masuhiro Y., Watanabe M., Kase T., Metzger D., Yanagisawa J., Kato S.
RT p300 mediates functional synergism between AF-1 and AF-2 of estrogen receptor alpha and beta by interacting directly with the N-terminal A/B domains
RL J. Biol. Chem. 275:15645-51 (2000).
RN [8]; RE0044905.
RX PUBMED: 11773441.
RA Lee S. R., Ramos S. M., Ko A., Masiello D., Swanson K. D., Lu M. L., Balk S. P.
RT AR and ER interaction with a p21-activated kinase (PAK6)
RL Mol. Endocrinol. 16:85-99 (2002).
RN [9]; RE0046545.
RX PUBMED: 11358960.
RA Chan S. W., Hong W.
RT Retinoblastoma-binding protein 2 (Rbp2) potentiates nuclear hormone receptor-mediated transcription
RL J. Biol. Chem. 276:28402-12 (2001).
RN [10]; RE0047444.
RX PUBMED: 15666801.
RA Kobayashi S., Shibata H., Yokota K., Suda N., Murai A., Kurihara I., Saito I., Saruta T.
RT FHL2, UBC9, and PIAS1 are novel estrogen receptor alpha-interacting proteins.
RL Endocr. Res. 30:617-621 (2004).
RN [11]; RE0047578.
RX PUBMED: 11981030.
RA Garcia Pedrero J. M., Del Rio B., Martinez-Campa C., Muramatsu M., Lazo P. S., Ramos S.
RT Calmodulin is a selective modulator of estrogen receptors.
RL Mol. Endocrinol. 16:947-960 (2002).
RN [12]; RE0047600.
RX PUBMED: 9717844.
RA Lee S. K., Choi H. S., Song M. R., Lee M. O., Lee J. W.
RT Estrogen receptor, a common interaction partner for a subset of nuclear receptors.
RL Mol. Endocrinol. 12:1184-1192 (1998).
RN [13]; RE0047611.
RX PUBMED: 15496419.
RA Meng G., Zhao Y., Nag A., Zeng M., Dimri G., Gao Q., Wazer D. E., Kumar R., Band H., Band V.
RT Human ADA3 binds to estrogen receptor (ER) and functions as a coactivator for ER-mediated transactivation.
RL J. Biol. Chem. 279:54230-54240 (2004).
RN [14]; RE0047615.
RX PUBMED: 16051668.
RA Leong H., Sloan J. R., Nash P. D., Greene G. L.
RT Recruitment of histone deacetylase 4 to the N-terminal region of estrogen receptor alpha.
RL Mol. Endocrinol. 19:2930-2942 (2005).
RN [15]; RE0047675.
RX PUBMED: 15886699.
RA Wada-Hiraike O., Yano T., Nei T., Matsumoto Y., Nagasaka K., Takizawa S., Oishi H., Arimoto T., Nakagawa S., Yasugi T., Kato S., Taketani Y.
RT The DNA mismatch repair gene hMSH2 is a potent coactivator of oestrogen receptor alpha.
RL Br. J. Cancer 92:2286-2291 (2005).
RN [16]; RE0047710.
RX PUBMED: 9440806.
RA Powers C. A., Mathur M., Raaka B. M., Ron D., Samuels H. H.
RT TLS (translocated-in-liposarcoma) is a high-affinity interactor for steroid, thyroid hormone, and retinoid receptors.
RL Mol. Endocrinol. 12:4-18 (1998).
RN [17]; RE0047715.
RX PUBMED: 11266503.
RA Zilliacus J., Holter E., Wakui H., Tazawa H., Treuter E., Gustafsson J. A.
RT Regulation of glucocorticoid receptor activity by 14--3-3-dependent intracellular relocalization of the corepressor RIP140.
RL Mol. Endocrinol. 15:501-511 (2001).
RN [18]; RE0047822.
RX PUBMED: 10903152.
RA Hulkko S. M., Wakui H., Zilliacus J.
RT The pro-apoptotic protein death-associated protein 3 (DAP3) interacts with the glucocorticoid receptor and affects the receptor function.
RL Biochem. J. 349:885-893 (2000).
RN [19]; RE0048210.
RX PUBMED: 15988012.
RA Chen Y. H., Kim J. H., Stallcup M. R.
RT GAC63, a GRIP1-dependent nuclear receptor coactivator.
RL Mol. Cell. Biol. 25:5965-5972 (2005).
RN [20]; RE0048228.
RX PUBMED: 8754792.
RA Takeshita A., Yen P. M., Misiti S., Cardona G. R., Liu Y., Chin W. W.
RT Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator.
RL Endocrinology 137:3594-3597 (1996).
RN [21]; RE0048506.
RX PUBMED: 16914745.
RA Wu Y., Kawate H., Ohnaka K., Nawata H., Takayanagi R.
RT Nuclear compartmentalization of N-CoR and its interactions with steroid receptors.
RL Mol. Cell. Biol. 26:6633-6655 (2006).
RN [22]; RE0048797.
RX PUBMED: 11279135.
RA Wang C., Fu M., Angeletti R. H., Siconolfi-Baez L., Reutens A. T., Albanese C., Lisanti M. P., Katzenellenbogen B. S., Kato S., Hopp T., Fuqua S. A., Lopez G. N., Kushner P. J., Pestell R. G.
RT Direct acetylation of the estrogen receptor alpha hinge region by p300 regulates transactivation and hormone sensitivity.
RL J. Biol. Chem. 276:18375-18383 (2001).
RN [23]; RE0048863.
RX PUBMED: 12904255.
RA Webb P., Valentine C., Nguyen P., Price RH J. r., Marimuthu A., West B. L., Baxter J. D., Kushner P. J.
RT ERbeta Binds N-CoR in the Presence of Estrogens via an LXXLL-like Motif in the N-CoR C-terminus.
RL Nucl. Recept. 1:4 (2003).
RN [24]; RE0048879.
RX PUBMED: 11818500.
RA Marimuthu A., Feng W., Tagami T., Nguyen H., Jameson J. L., Fletterick R. J., Baxter J. D., West B. L.
RT TR surfaces and conformations required to bind nuclear receptor corepressor.
RL Mol. Endocrinol. 16:271-286 (2002).
RN [25]; RE0049387.
RX PUBMED: 15961505.
RA Sentis S., Le Romancer M., Bianchin C., Rostan M. C., Corbo L.
RT Sumoylation of the estrogen receptor alpha hinge region regulates its transcriptional activity.
RL Mol. Endocrinol. 19:2671-2684 (2005).
RN [26]; RE0049909.
RX PUBMED: 16497729.
RA Kim M. Y., Woo E. M., Chong Y. T., Homenko D. R., Kraus W. L.
RT Acetylation of estrogen receptor alpha by p300 at lysines 266 and 268 enhances the deoxyribonucleic acid binding and transactivation activities of the receptor.
RL Mol. Endocrinol. 20:1479-1493 (2006).
RN [27]; RE0050034.
RX PUBMED: 17130235.
RA Bao J., Cao C., Zhang X., Jiang F., Nicosia S. V., Bai W.
RT Suppression of beta-amyloid precursor protein signaling into the nucleus by estrogens mediated through complex formation between the estrogen receptor and Fe65.
RL Mol. Cell. Biol. 27:1321-1333 (2007).
RN [28]; RE0050597.
RX PUBMED: 10681503.
RA Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J. A.
RT Cloning and characterization of RAP250, a novel nuclear receptor coactivator.
RL J. Biol. Chem. 275:5308-5317 (2000).
RN [29]; RE0051649.
RX PUBMED: 12093745.
RA Metivier R., Gay F. A., Hubner M. R., Flouriot G., Salbert G., Gannon F., Kah O., Pakdel F.
RT Formation of an hER alpha-COUP-TFI complex enhances hER alpha AF-1 through Ser118 phosphorylation by MAPK.
RL EMBO J. 21:3443-3453 (2002).
RN [30]; RE0053695.
RX PUBMED: 17395984.
RA Galluzzo P., Caiazza F., Moreno S., Marino M.
RT Role of ERbeta palmitoylation in the inhibition of human colon cancer cell proliferation.
RL Endocr. Relat. Cancer 14:153-167 (2007).
RN [31]; RE0053742.
RX PUBMED: 15496458.
RA Acconcia F., Ascenzi P., Bocedi A., Spisni E., Tomasi V., Trentalance A., Visca P., Marino M.
RT Palmitoylation-dependent estrogen receptor alpha membrane localization: regulation by 17beta-estradiol.
RL Mol. Biol. Cell 16:231-237 (2005).
RN [32]; RE0053992.
RX PUBMED: 16037132.
RA Fan M., Park A., Nephew K. P.
RT CHIP (carboxyl terminus of Hsc70-interacting protein) promotes basal and geldanamycin-induced degradation of estrogen receptor-alpha.
RL Mol. Endocrinol. 19:2901-2914 (2005).
RN [33]; RE0054247.
RX PUBMED: 15604293.
RA Cui Y., Zhang M., Pestell R., Curran E. M., Welshons W. V., Fuqua S. A.
RT Phosphorylation of estrogen receptor alpha blocks its acetylation and regulates estrogen sensitivity.
RL Cancer Res. 64:9199-9208 (2004).
RN [34]; RE0054582.
RX PUBMED: 18388150.
RA Berry N. B., Fan M., Nephew K. P.
RT Estrogen receptor-alpha hinge-region lysines 302 and 303 regulate receptor degradation by the proteasome.
RL Mol. Endocrinol. 22:1535-1551 (2008).
RN [35]; RE0063919.
RX PUBMED: 17609434.
RA Grisouard J., Medunjanin S., Hermani A., Shukla A., Mayer D.
RT Glycogen synthase kinase-3 protects estrogen receptor alpha from proteasomal degradation and is required for full transcriptional activity of the receptor.
RL Mol. Endocrinol. 21:2427-2439 (2007).
RN [36]; RE0052502.
RX PUBMED: 9713824.
RA Biswas D. K., Averboukh L., Sheng S., Martin K., Ewaniuk D. S., Jawde T. F., Wang F., Pardee A. B.
RT Classification of breast cancer cells on the basis of a functional assay for estrogen receptor.
RL Mol. Med. 4:454-467 (1998).
RN [37]; RE0001827.
RX PUBMED: 3754034.
RA Green S., Walter P., Kumar V., Krust A., Bornert J.-M., Argos P., Chambon P.
RT Human oestrogen receptor cDNA: sequence, expression and homology to v-erb-A
RL Nature 320:134-139 (1986).
XX
//