AC T00853
XX
ID T00853
XX
DT 14.12.1992 (created); ewi.
DT 27.09.2011 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA T3R-beta1
XX
SY Nuclear receptor subfamily 1 group A member 2; T3R-beta1; thyroid hormone receptor beta; thyroid hormone receptor-beta1; TR.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G005222 Thrb.
XX
CL C0002; CC (rec); 2.1.2.2.2.1.
XX
SZ 461 AA; 52.7 kDa (cDNA) (calc.).
XX
SQ MTPNSMTENRLPAWDKQKPHPDRGQDWKLVGMSEACLHRKSHVERRGALKNEQTSSHLIQ
SQ ATWASSIFHLDPDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
SQ CITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATDLVL
SQ DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
SQ QKRKFLPEDIGQAPIVNAPEGGQVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
SQ QIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SQ SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
SQ LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
XX
SC Swiss-Prot#P18113-1
XX
FT 104 177 
SM00399; c4gold.
FT 104 181 
PS51030; NUCLEAR_REC_DBD_2.
FT 105 182 
PF00105; Zinc finger, C4 type (two domains).
FT 137 383 
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 274 432 
SM00430; holi.
FT 277 458 
PF00104; Ligand-binding domain of nuclear hormon.
XX
SF another splice variant produced by the same gene, T3R-beta2 T01350;
XX
CP anterior pituitary gland, parvocellular part of the paraventricular hypothalamic nucleus.
XX
FF mediating thyroid hormone feedback regulation of thyroid-stimulating hormone and thyrotropin-releasing hormone;
XX
IN T08910 Bcl-3; human, Homo sapiens.
IN T34265 COPS2; human, Homo sapiens.
IN T33762 DRIP205; human, Homo sapiens.
IN T08300 ER-alpha-L; human, Homo sapiens.
IN T28749 HMGN3; human, Homo sapiens.
IN T00414 IkappaB-beta; human, Homo sapiens.
IN T01332 RXR-beta; mouse, Mus musculus.
IN T01334 RXR-beta; human, Homo sapiens.
IN T01349 RXR-beta; rat, Rattus norvegicus.
IN T08947 SHP; mouse, Mus musculus.
IN T22416 SRC-1 (-Q); human, Homo sapiens.
IN T01355 TRAP; human, Homo sapiens.
XX
MX M02119 V$T3RBETA_Q6_01.
MX M00963 V$T3R_Q6.
XX
BS R01465.
BS R03952.
BS R04508.
BS R01673.
BS R36746.
BS R36748.
BS R36756.
BS R36749.
BS R03942.
BS R03102.
BS R02595.
BS R03886.
BS R04401.
BS R04402.
BS R36751.
BS R26507.
BS R26508.
BS R26509.
BS R20554.
BS R00619.
BS R01617.
BS R20540.
BS R35705.
BS R36742.
BS R02694.
BS R02695.
BS R02696.
BS R30867.
BS R36755.
BS R03523.
XX
DR TRANSPATH: MO000025219.
DR EMBL: J03933;
DR UniProtKB: P18113-1;
XX
RN [1]; RE0000878.
RX PUBMED: 2457590.
RA Murray M. B., Zilz N. D., McCreary N. L., MacDonald M. J., Towle H. C.
RT Isolation and characterization of rat cDNA clones for two distinct thyroid hormone receptors
RL J. Biol. Chem. 263:12770-12777 (1988).
RN [2]; RE0000904.
RX PUBMED: 2159469.
RA Zilz N. D., Murray M. B., Towle H. C.
RT Identification of Multiple Thyroid Hormone Response Elements Located Far Upstream from the Rat S14 Promoter
RL J. Biol. Chem. 265:8136-8143 (1990).
RN [3]; RE0001084.
RX PUBMED: 8389356.
RA Rosen E. D., Beninghof E. G., Koenig R. J.
RT Dimerization interfaces of thyroid hormone, retinoic acid, vitamin D, and retinoid X receptors
RL J. Biol. Chem. 268:11534-11541 (1993).
RN [4]; RE0001085.
RX PUBMED: 1675637.
RA Selmi S., Samuels H. H.
RT Thyroid hormone receptor / and v-erbA: a single amino acid difference in the C-terminal region influences dominant negative activity and receptor dimer formation
RL J. Biol. Chem. 266:11589-11593 (1991).
RN [5]; RE0002371.
RX PUBMED: 2899322.
RA Koenig R. J., Warne R. L., Brent G. A., Harney J. W., Larsen P. R., Moore D. D.
RT Isolation of a cDNA clone encoding a biologically active thyroid hormone receptor
RL Proc. Natl. Acad. Sci. USA 85:5031-5035 (1988).
RN [6]; RE0025766.
RX PUBMED: 12048199.
RA Lin H. M., Zhao L., Cheng S. Y.
RT Cyclin D1 Is a Ligand-independent Co-repressor for Thyroid Hormone Receptors.
RL J. Biol. Chem. 277:28733-41 (2002).
RN [7]; RE0028212.
RX PUBMED: 9372944.
RA Seol W., Chung M., Moore D. D.
RT Novel receptor interaction and repression domains in the orphan receptor SHP.
RL Mol. Cell. Biol. 17:7126-31 (1997).
RN [8]; RE0042804.
RX PUBMED: 10454579.
RA Kim H. J., Yi J. Y., Sung H. S., Moore D. D., Jhun B. H., Lee Y. C., Lee J. W.
RT Activating signal cointegrator 1, a novel transcription coactivator of nuclear receptors, and its cytosolic localization under conditions of serum deprivation
RL Mol. Cell. Biol. 19:6323-32 (1999).
RN [9]; RE0047529.
RX PUBMED: 11641275.
RA Potter G. B., Beaudoin GM 3. r. d., DeRenzo C. L., Zarach J. M., Chen S. H., Thompson C. C.
RT The hairless gene mutated in congenital hair loss disorders encodes a novel nuclear receptor corepressor.
RL Genes Dev. 15:2687-2701 (2001).
RN [10]; RE0047584.
RX PUBMED: 10823961.
RA Ko L., Cardona G. R., Chin W. W.
RT Thyroid hormone receptor-binding protein, an LXXLL motif-containing protein, functions as a general coactivator.
RL Proc. Natl. Acad. Sci. USA 97:6212-6217 (2000).
RN [11]; RE0047600.
RX PUBMED: 9717844.
RA Lee S. K., Choi H. S., Song M. R., Lee M. O., Lee J. W.
RT Estrogen receptor, a common interaction partner for a subset of nuclear receptors.
RL Mol. Endocrinol. 12:1184-1192 (1998).
RN [12]; RE0047680.
RX PUBMED: 9812988.
RA Na S. Y., Choi H. S., Kim J. W., Na D. S., Lee J. W.
RT Bcl3, an IkappaB protein, as a novel transcription coactivator of the retinoid X receptor.
RL J. Biol. Chem. 273:30933-30938 (1998).
RN [13]; RE0047744.
RX PUBMED: 7776974.
RA Lee J. W., Choi H. S., Gyuris J., Brent R., Moore D. D.
RT Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.
RL Mol. Endocrinol. 9:243-254 (1995).
RN [14]; RE0048228.
RX PUBMED: 8754792.
RA Takeshita A., Yen P. M., Misiti S., Cardona G. R., Liu Y., Chin W. W.
RT Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator.
RL Endocrinology 137:3594-3597 (1996).
XX
//