AC T08910
XX
ID T08910
XX
DT 11.05.2006 (created); jag.
DT 10.04.2013 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Bcl-3
XX
SY B-cell leukemia/lymphoma 3; Bcl3.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004492 BCL3; HGNC: Bcl3.
XX
CL C0020; Rel.
XX
SZ 454 AA; 47.6 kDa (cDNA) (calc.).
XX
SQ MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
SQ RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
SQ LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
SQ ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
SQ DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
SQ NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
SQ KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
SQ FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
XX
SC Swiss-Prot#P20749
XX
FT 101 400 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 126 159 
SM00248; ANK_2a.
FT 126 162 
PF00023; Ankyrin repeat.
FT 126 162 
PS50088; ANK_REPEAT.
FT 126 351 
PS50297; ANK_REP_REGION.
FT 163 192 
SM00248; ANK_2a.
FT 163 195 
PF00023; Ankyrin repeat.
FT 163 195 
PS50088; ANK_REPEAT.
FT 196 227 
SM00248; ANK_2a.
FT 196 232 
PF00023; Ankyrin repeat.
FT 233 262 SM00248; ANK_2a.
FT 233 265 PF00023; Ankyrin repeat.
FT 233 265 PS50088; ANK_REPEAT.
FT 267 296 SM00248; ANK_2a.
FT 267 299 PF00023; Ankyrin repeat.
FT 267 299 PS50088; ANK_REPEAT.
FT 300 329 SM00248; ANK_2a.
FT 300 332 PF00023; Ankyrin repeat.
FT 300 332 PS50088; ANK_REPEAT.
XX
IN T14760 ERR1; Mammalia.
IN T21852 HDAC1; Mammalia.
IN T08934 NF-kappaB1-isoform1; human, Homo sapiens.
IN T10399 NF-kappaB1-p50; Mammalia.
IN T00394 NF-kappaB2-p52; human, Homo sapiens.
IN T10456 p50; human, Homo sapiens.
IN T08255 PGC-1-isoform1; mouse, Mus musculus.
IN T08433 RXR-alpha; human, Homo sapiens.
IN T00853 T3R-beta1; rat, Rattus norvegicus.
IN T14175 TBP; Mammalia.
IN T17428 TFIIB; Mammalia.
IN T27164 Tip60; human, Homo sapiens.
XX
DR TRANSPATH: MO000081305.
DR EMBL: M31732;
DR UniProtKB: P20749;
XX
RN [1]; RE0002005.
RX PUBMED: 2566973.
RA Fujita T., Miyamoto M., Kimura Y., Hammer J., Taniguchi T.
RT Involvement of a cis-element that binds an H2TF-1/NFkappaB like factor(s) in the virus-induced interferon-beta gene expression
RL Nucleic Acids Res. 17:3335-3346 (1989).
RN [2]; RE0004492.
RX PUBMED: 8196632.
RA Zhang Q., Didonato J. A., Karin M., McKeithan T. W.
RT BCL3 encodes a nuclear protein which can alter the subcellular location of NF-kappaB proteins
RL Mol. Cell. Biol. 14:3915-3926 (1994).
RN [3]; RE0004493.
RX PUBMED: 7559449.
RA Pan J., McEver R. P.
RT Regulation of the human P-selection promoter by Bcl-3 and specific homodimeric members of the NF-kappaB/Rel family
RL J. Biol. Chem. 270:23077-23083 (1995).
RN [4]; RE0004508.
RX PUBMED: 1532257.
RA Hatada E. N., Nieters A., Wulczyn F. G., Naumann M., Meyer R., Nucifora G., McKeithan T. W., Scheidereit C.
RT The ankyrin repeat domains of the NF-kappaB precursor p105 and the protooncogene bcl-3 act as specific inhibitors of NF- kappaB DNA binding
RL Proc. Natl. Acad. Sci. USA 89:2489-2493 (1992).
RN [5]; RE0004509.
RX PUBMED: 8428580.
RA Naumann M., Wulczyn F. G., Scheidereit C.
RT The NF-kappaB precursor p105 and the proto-oncogene product Bcl-3 are IkappaB molecules and control nuclear translocation of NF-kappaB
RL EMBO J. 12:213-222 (1993).
RN [6]; RE0004510.
RX PUBMED: 8330739.
RA Fujita T., Nolan G. P., Liou H.-C., Scott M. L., Baltimore D.
RT The candidate proto-oncogene bcl-3 encodes a transcriptional coactivator that activates through NF-kappaB p50 homodimers
RL Genes Dev. 7:1354-1363 (1993).
RN [7]; RE0004519.
RX PUBMED: 1740105.
RA Ten R. M., Paya C. V., Israel N., Le Bail O., Mattei M.-G., Virelizier J.-L., Kurilsky P., IsraNl A.
RT The characterization of the promoter of the gene encoding the p50 subunit of NF-kappaB indicates that it participates in its own regulation
RL EMBO J. 11:195-203 (1992).
RN [8]; RE0004617.
RX PUBMED: 1459457.
RA Kerr L. D., Duckett C. S., Wamsley P., Zhang Q., Chiao P., Nabel G., McKeithan T. W., Baeuerle P. A., Verma I. M.
RT The proto-oncogene BCL-3 encodes an IkappaB protein
RL Genes Dev. 6:2352-2363 (1992).
RN [9]; RE0004618.
RX PUBMED: 8497270.
RA Nolan G. P., Fujita T., Bhatia K., Huppi C., Liou H.-C., Scott M. L., Baltimore D.
RT The bcl-3 proto-oncogene encodes a nuclear IkappaB-like molecule that preferentially interacts with NF-kappaB p50 and p52 in a phosphorylation-dependent manner
RL Mol. Cell. Biol. 13:3557-3566 (1993).
RN [10]; RE0004619.
RX PUBMED: 8404857.
RA Franzoso G., Bours V., Azarenko V., Park S., Tomita-Ymaguchi M., Kanno T., Brown K., Siebenlist U.
RT The oncoprotein Bcl-3 can facilitate NF-kappaB mediated transactivation by removing inhibiting p50 homodimers from select kappaB sites
RL EMBO J. 12:3893-3901 (1993).
RN [11]; RE0004620.
RX PUBMED: 2180580.
RA Ohno H., Takimoto G., McKeithan T. W.
RT The candidate proto-oncogene bcl-3 is related to genes implicated in cell lineage determination and cell-cycle control
RL Cell 60:991-997 (1990).
RN [12]; RE0004621.
RX PUBMED: 1501714.
RA Wulczyn F. G., Naumann M., Scheidereit C.
RT Candidate proto-oncogene bcl-3 encodes a subunit-specific inhibitor of transcription factor NF-kappaB
RL Nature 358:597-599 (1992).
RN [13]; RE0004622.
RX PUBMED: 1406939.
RA Franzoso G., Bours V., Park S., Tomita-Yamaguchi M., Kelly K., Siebenlist U.
RT The candidate oncoprotein bcl-3 is an antagonist of p50/NF-kappaB-mediated inhibition
RL Nature 359:339-342 (1992).
RN [14]; RE0004641.
RX PUBMED: 7896265.
RA McKeithan T. W., Ohno H., Dickstein J.
RT Genomic structure of the candidate proto-oncogene BCL-3
RL Genomics 247:120-126 (1994).
RN [15]; RE0028144.
RX PUBMED: 10362352.
RA Dechend R., Hirano F., Lehmann K., Heissmeyer V., Ansieau S., Wulczyn F. G., Scheidereit C., Leutz A.
RT The Bcl-3 oncoprotein acts as a bridging factor between NF-kappaB/Rel and nuclear co-regulators.
RL Oncogene 18:3316-23 (1999).
RN [16]; RE0047680.
RX PUBMED: 9812988.
RA Na S. Y., Choi H. S., Kim J. W., Na D. S., Lee J. W.
RT Bcl3, an IkappaB protein, as a novel transcription coactivator of the retinoid X receptor.
RL J. Biol. Chem. 273:30933-30938 (1998).
RN [17]; RE0047796.
RX PUBMED: 15469820.
RA Viatour P., Dejardin E., Warnier M., Lair F., Claudio E., Bureau F., Marine J. C., Merville M. P., Maurer U., Green D., Piette J., Siebenlist U., Bours V., Chariot A.
RT GSK3-mediated BCL-3 phosphorylation modulates its degradation and its oncogenicity.
RL Mol. Cell 16:35-45 (2004).
RN [18]; RE0053639.
RX PUBMED: 15465827.
RA Wessells J., Baer M., Young H. A., Claudio E., Brown K., Siebenlist U., Johnson P. F.
RT BCL-3 and NF-kappaB p50 attenuate lipopolysaccharide-induced inflammatory responses in macrophages.
RL J. Biol. Chem. 279:49995-50003 (2004).
XX
//