AC T08934
XX
ID T08934
XX
DT 16.05.2006 (created); kau.
DT 05.11.2013 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA NF-kappaB1-isoform1
XX
SY EBP-1; KBF1; MGC54151; NF-kappa-B; NF-kappaB (p50); NF-kappaB1 (p105); NF-kappaB1 (p110); NFkappaB1 precursor (p105); NFKB-p105; NFKB-p50; NFKB1; Nuclear factor NF-kappa-B p105 subunit; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (p105); p105; p110; p50.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G000356 NFKB1; HGNC: NFKB1.
XX
CL C0020; Rel; 6.1.1.1.1.1.
XX
SZ 968 AA; 105.4 kDa (cDNA) (calc.), 105 kDa (SDS)
XX
SQ MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
SQ CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
SQ GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
SQ EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
SQ DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SQ SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
SQ RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
SQ PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
SQ VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
SQ ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
SQ LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SQ SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
SQ TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SQ SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
SQ LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
SQ AHSLPLSPASTRQQIDELRDSDSVCDTGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
SQ EGPLEGKI
XX
SC translated from EMBL:M58603
XX
IN T08910 Bcl-3; human, Homo sapiens.
IN T05076 GR; human, Homo sapiens.
XX
MX M00194 V$NFKB_Q6.
MX M00774 V$NFKB_Q6_01.
XX
DR TRANSPATH: MO000081506.
DR EMBL: M55643; HSNFKB34.
DR EMBL: M58603;
DR UniProtKB: P19838-1; KB1_HUMAN.
XX
RN [1]; RE0000172.
RX PUBMED: 2203531.
RA Kieran M., Blank V., Logeat F., Vandekerckhove J., Lottspeich F., Le Bail O., Urban M. B., Kourilsky P., Baeuerle B. A., Israel A.
RT The DNA binding subunit of NF-kappaB is identical to factor KBF1 and homologous to the rel oncogene product
RL Cell 62:1007-1018 (1990).
RN [2]; RE0001870.
RX PUBMED: 2234062.
RA Bours V., Villalobos J., Burd P. R., Kelly K., Siebenlist U.
RT Cloning of a mitogen-inducible gene encoding a kappaB DNA-binding protein with homology to the rel oncogene and to cell-cycle motifs
RL Nature 348:76-80 (1990).
RN [3]; RE0001872.
RX PUBMED: 2017258.
RA Riviere Y., Blank V., Kourilsky P., Israel A.
RT Processing of the precursor of NF-kappaB by the HIV-1 protease during acute infection
RL Nature 350:625-626 (1991).
RN [4]; RE0001873.
RX PUBMED: 1876189.
RA Schmid R. M., Perkins N. D., Duckett C. S., Andrews P. C., Nabel G. J.
RT Cloning of an NF-kappaB subunit which stimulates HIV transcription in synergy with p65
RL Nature 352:733-736 (1991).
RN [5]; RE0001874.
RX PUBMED: 1956402.
RA Fan C.-M., Maniatis T.
RT Generation of p50 subunit of NF-kappaB by processing of p105 through an ATP-dependent pathway
RL Nature 354:395-398 (1991).
RN [6]; RE0002489.
RX PUBMED: 1992489.
RA Meyer R., Hatada E. N., Hohmann H.-P., Haiker M., Bartsch C., Roethlisberger U., Lahm H.-W., Schlaeger E. J., van Loon A. P. G. M., Scheidereit C.
RT Cloning of the DNA-binding subunit of human nuclear factor kappaB: the level of its mRNA is strongly regulated by phorbol ester or tumor necrosis factor alpha
RL Proc. Natl. Acad. Sci. USA 88:966-970 (1991).
RN [7]; RE0002873.
RX PUBMED: 1756723.
RA Blank V., Kourilsky P., Israel A.
RT Cytoplasmic retention, DNA binding and processing of the NF--kappaB p50 precursor are controlled by a small region in its C-terminus
RL EMBO J. 10:4159-4167 (1991).
RN [8]; RE0004490.
RX PUBMED: 8255759.
RA Mellits K. H., Hay R. T., Goodbourn S.
RT Proteolytic degradation of MAD3 (IkappaBkappa) and enhanced processing of the NF-kappaB precursor p105 are obligatory steps in the activation of NF-kappaB
RL Nucleic Acids Res. 21:5059-5066 (1993).
RN [9]; RE0004495.
RX PUBMED: 1547506.
RA Henkel T., Zabel U., van Zee K., Mueller J. M., Fanning E., Baeuerle P. A.
RT Intramolecular masking of the nuclear location signal and dimerization domain in the precursor for the p50 NF-kappaB subunit
RL Cell 68:1121-1133 (1992).
RN [10]; RE0004497.
RX PUBMED: 1508666.
RA Matthews J. R., Wakasugi N., Virelizier J. L., Yodoi J., Hay R. T.
RT Thioredoxin regulates the DNA binding activity of NF-kappaB by reduction of a disulphide bond involving cysteine 62
RL Nucleic Acids Res. 20:3821-3830 (1992).
RN [11]; RE0004507.
RX PUBMED: 7925300.
RA Naumann M., Scheidereit C.
RT Activation of NF-6B in vivo is regulated by multiple phosphorylations
RL EMBO J. 13:4597-4607 (1994).
RN [12]; RE0004508.
RX PUBMED: 1532257.
RA Hatada E. N., Nieters A., Wulczyn F. G., Naumann M., Meyer R., Nucifora G., McKeithan T. W., Scheidereit C.
RT The ankyrin repeat domains of the NF-kappaB precursor p105 and the protooncogene bcl-3 act as specific inhibitors of NF- kappaB DNA binding
RL Proc. Natl. Acad. Sci. USA 89:2489-2493 (1992).
RN [13]; RE0004509.
RX PUBMED: 8428580.
RA Naumann M., Wulczyn F. G., Scheidereit C.
RT The NF-kappaB precursor p105 and the proto-oncogene product Bcl-3 are IkappaB molecules and control nuclear translocation of NF-kappaB
RL EMBO J. 12:213-222 (1993).
RN [14]; RE0004515.
RX PUBMED: 1501885.
RA Hirai H., Fujisawa J., Suzuki T., Ueda K., Muramatsu M., Tsuboi A., Arai N., Yoshida M.
RT Transcriptional activator Tax of HTLV-1 binds to the NF-kappaB precursor p105
RL Oncogene 7:1737-1742 (1992).
RN [15]; RE0004516.
RX PUBMED: 1502202.
RA Paya C. V., Ten R. M., Bessia C., Alcami J., Hay R. T., Virelizier J.-L.
RT NF-kappaB-dependent induction of the NF-kappaB p50 subunit gene promoter underlies self-perpetuation of human immunodeficiency virus transcription in monocytic cells
RL Proc. Natl. Acad. Sci. USA 89:7826-7830 (1992).
RN [16]; RE0004519.
RX PUBMED: 1740105.
RA Ten R. M., Paya C. V., Israel N., Le Bail O., Mattei M.-G., Virelizier J.-L., Kurilsky P., IsraNl A.
RT The characterization of the promoter of the gene encoding the p50 subunit of NF-kappaB indicates that it participates in its own regulation
RL EMBO J. 11:195-203 (1992).
RN [17]; RE0004528.
RX PUBMED: 8087845.
RA Palombella V. J., Rando O. J., Goldberg A. L., Maniatis T.
RT The ubiquitin-proteasome pathway is required for processing the NF-kappaB1 precursor protein and the activation of NF-kappaB
RL Cell 78:773-785 (1994).
RN [18]; RE0018975.
RX PUBMED: 10835356.
RA Orian A., Gonen H., Bercovich B., Fajerman I., Eytan E., Israel A., Mercurio F., Iwai K., Schwartz A. L., Ciechanover A.
RT SCFbeta-TrCP ubiquitin ligase-mediated processing of NF-kappaB p105 requires phosphorylation of its C-terminus by IkappaB kinase
RL EMBO J. 19:2580-2591 (2000).
RN [19]; RE0030766.
RX PUBMED: 12482991.
RA Lang V., Janzen J., Fischer G. Z., Soneji Y., Beinke S., Salmeron A., Allen H., Hay R. T., Ben-Neriah Y., Ley S. C.
RT betaTrCP-mediated proteolysis of NF-kappaB1 p105 requires phosphorylation of p105 serines 927 and 932.
RL Mol. Cell. Biol. 23:402-13 (2003).
RN [20]; RE0047745.
RX PUBMED: 14673179.
RA Cohen S., Achbert-Weiner H., Ciechanover A.
RT Dual effects of IkappaB kinase beta-mediated phosphorylation on p105 Fate: SCF(beta-TrCP)-dependent degradation and SCF(beta-TrCP)-independent processing.
RL Mol. Cell. Biol. 24:475-486 (2004).
RN [21]; RE0047755.
RX PUBMED: 16678126.
RA Cohen S., Lahav-Baratz S., Ciechanover A.
RT Two distinct ubiquitin-dependent mechanisms are involved in NF-kappaB p105 proteolysis.
RL Biochem. Biophys. Res. Commun. 345:7-13 (2006).
RN [22]; RE0047796.
RX PUBMED: 15469820.
RA Viatour P., Dejardin E., Warnier M., Lair F., Claudio E., Bureau F., Marine J. C., Merville M. P., Maurer U., Green D., Piette J., Siebenlist U., Bours V., Chariot A.
RT GSK3-mediated BCL-3 phosphorylation modulates its degradation and its oncogenicity.
RL Mol. Cell 16:35-45 (2004).
RN [23]; RE0048131.
RX PUBMED: 7823959.
RA Scheinman R. I., Gualberto A., Jewell C. M., Cidlowski J. A., Baldwin AS J. r.
RT Characterization of mechanisms involved in transrepression of NF-kappa B by activated glucocorticoid receptors.
RL Mol. Cell. Biol. 15:943-953 (1995).
RN [24]; RE0051644.
RX PUBMED: 11239468.
RA Xiao G., Harhaj E. W., Sun S. C.
RT NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100.
RL Mol. Cell 7:401-409 (2001).
RN [25]; RE0052023.
RX PUBMED: 16901920.
RA Frommer K. W., Reichenmiller K., Schutt B. S., Hoeflich A., Ranke M. B., Dodt G., Elmlinger M. W.
RT IGF-independent effects of IGFBP-2 on the human breast cancer cell line Hs578T.
RL J. Mol. Endocrinol. 37:13-23 (2006).
RN [26]; RE0054072.
RX PUBMED: 11687592.
RA Solan N. J., Miyoshi H., Carmona E. M., Bren G. D., Paya C. V.
RT RelB cellular regulation and transcriptional activity are regulated by p100.
RL J. Biol. Chem. 277:1405-1418 (2002).
RN [27]; RE0054190.
RX PUBMED: 12820969.
RA Saccani S., Pantano S., Natoli G.
RT Modulation of NF-kappaB activity by exchange of dimers.
RL Mol. Cell 11:1563-1574 (2003).
XX
//