TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08947 XX ID T08947 XX DT 18.05.2006 (created); jag. DT 03.10.2012 (updated); spk. CO Copyright (C), QIAGEN. XX FA SHP XX SY NR0B2; short heterodimer partner; SHP-1; small heterodimer partner. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002555 Nr0b2. XX CL C0002; CC (rec). XX SZ 260 AA; 28.8 kDa (cDNA) (calc.). XX SQ MSSGQSGVCPCQGSAGRPTILYALLSPSPRTRPVAPASHSHCLCQQQRPVRLCAPHRTCR SQ EALDVLAKTVAFLRNLPSFCHLPHEDQRRLLECCWGPLFLLGLAQDAVTFEVAEAPVPSI SQ LKKILLEEASSGTQGAQPSDRPQPSLAAVQWLQRCLESFWSLELGPKEYAYLKGTILFNP SQ DVPGLRASCHIAHLQQEAHWALCEVLEPWYPASQGRLARILLMASTLKNIPGTLLVDLFF SQ RPIMGDVDITELLEDMLLLR XX SC translated from EMBL #BC019540 XX FT 60 231 SM00430; holi. FT 63 256 PF00104; Ligand-binding domain of nuclear hormon. XX IN T08664 C/EBPalpha; Mammalia. IN T05687 CAR; mouse, Mus musculus. IN T02770 LRH-1; human, Homo sapiens. IN T02752 LXR-alpha; human, Homo sapiens. IN T01327 NR1B1; mouse, Mus musculus. IN T08433 RXR-alpha; human, Homo sapiens. IN T00853 T3R-beta1; rat, Rattus norvegicus. XX DR TRANSPATH: MO000081684. DR EMBL: BC019540; DR UniProtKB: Q62227; XX RN [1]; RE0016208. RX PUBMED: 11030331. RA Lu T. T., Makishima M., Repa J. J., Schoonjans K., Kerr T. A., Auwerx J., Mangelsdorf D. J. RT Molecular basis for feedback regulation of bile acid synthesis by nuclear receptors RL Mol. Cell 6:507-515 (2000). RN [2]; RE0028212. RX PUBMED: 9372944. RA Seol W., Chung M., Moore D. D. RT Novel receptor interaction and repression domains in the orphan receptor SHP. RL Mol. Cell. Biol. 17:7126-31 (1997). RN [3]; RE0042891. RX PUBMED: 12198243. RA Brendel C., Schoonjans K., Botrugno O. A., Treuter E., Auwerx J. RT The Small Heterodimer Partner Interacts with the Liver X Receptor alpha and Represses Its Transcriptional Activity RL Mol. Endocrinol. 16:2065-76 (2002). RN [4]; RE0053527. RX PUBMED: 17094771. RA Park M. J., Kong H. J., Kim H. Y., Kim H. H., Kim J. H., Cheong J. H. RT Transcriptional repression of the gluconeogenic gene PEPCK by the orphan nuclear receptor SHP through inhibitory interaction with C/EBPalpha. RL Biochem. J. 402:567-574 (2007). XX //