TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T06148 XX ID T06148 XX DT 17.09.2004 (created); oke. DT 08.01.2015 (updated); spk. CO Copyright (C), QIAGEN. XX FA p/CAF XX SY CAF; GCN5; GCN5L; GCN5L1; histone acetylase PCAF; Histone acetyltransferase PCAF; P/CAF; p300/CBP-associated factor; PCAF. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003808 KAT2B; HGNC: KAT2B. XX SZ 832 AA; 93.0 kDa (cDNA) (calc.). XX SQ MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA SQ AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP SQ PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED SQ ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE SQ RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR SQ YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ SQ NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG SQ LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA SQ RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD SQ PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH SQ DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS SQ VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK SQ EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR SQ YYVSKKLFMADLQRVFTNCKEYNAAESEYYKCANILEKFFFSKIKEAGLIDK XX SC translated from EMBL #U57317 XX FT 75 327 PF06466; PCAF (P300/CBP-associated factor) N-te. FT 419 742 PF00478; IMP dehydrogenase / GMP reductase doma. FT 546 623 PF00583; Acetyltransferase (GNAT) family. FT 721 829 SM00297; bromo_6. FT 728 815 PF00439; Bromodomain. FT 740 810 PS50014; BROMODOMAIN_2. XX SF contains HAT domain, bromodomain; SF HAT domain is essential for interactions with p73alpha T04931 and p73 beta T06137 [3]; XX FF co-activator with histone acetyltransferase activity [4] [1]; FF co-activator for p73alpha T04931 and p73beta T06137 [3]; XX IN T30262 alpha-actinin-4-isoform3; human, Homo sapiens. IN T08487 AR-isoform1; human, Homo sapiens. IN T01542 E2F-1; human, Homo sapiens. IN T09117 E2F-1; human, Homo sapiens. IN T08300 ER-alpha-L; human, Homo sapiens. IN T10210 Evi-1; human, Homo sapiens. IN T04106 HDAC1; human, Homo sapiens. IN T08343 HDAC1; human, Homo sapiens. IN T21852 HDAC1; Mammalia. IN T08893 hdac2; mouse, Mus musculus. IN T25621 huntingtin; human, Homo sapiens. IN T09323 IRF-1; human, Homo sapiens. IN T09325 IRF-2; mouse, Mus musculus. IN T10173 M-Twist; mouse, Mus musculus. IN T04546 NeuroD; human, Homo sapiens. IN T00616 NF-YB; mouse, Mus musculus. IN T02478 NF-YC-isoform3; human, Homo sapiens. IN T00671 p53; human, Homo sapiens. IN T04931 p73alpha; human, Homo sapiens. IN T06137 p73beta; human, Homo sapiens. IN T32366 SIRT1-isoform1; mouse, Mus musculus. IN T02113 TAFII31; human, Homo sapiens. IN T00793 Tax; HTLV-I, human T-cell lymphotropic virus type I. XX DR TRANSPATH: MO000023409. DR EMBL: U57317; DR UniProtKB: Q92831; XX RN [1]; RE0006116. RX PUBMED: 8684459. RA Yang X. J., Ogryzko V. V., Nishikawa J., Howard B. H., Nakatani Y. RT A p300/CBP-associated factor that competes with the adenoviral oncoprotein E1A RL Nature 382:319-324 (1996). RN [2]; RE0006142. RX PUBMED: 9296499. RA Spencer T. E., Jenster G., Burcin M. M., Allis C. D., Zhou J., Mizzen C. A., McKenna N. J., Onate S. A., Tsai S. Y., Tsai M. J., O'Malley B. W. RT Steroid receptor coactivator-1 is a histone acetyltransferase RL Nature 389:194-198 (1997). RN [3]; RE0024884. RX PUBMED: 14614455. RA Zhao L. Y., Liu Y., Bertos N. R., Yang X. J., Liao D. RT PCAF is a coactivator for p73-mediated transactivation. RL Oncogene 22:8316-8329 (2003). RN [4]; RE0024893. RX PUBMED: 8945521. RA Ogryzko V. V., Schiltz R. L., Russanova V., Howard B. H., Nakatani Y. RT The transcriptional coactivators p300 and CBP are histone acetyltransferases. RL Cell 87:953-959 (1996). RN [5]; RE0029363. RX PUBMED: 11568182. RA Chakraborty S., Senyuk V., Sitailo S., Chi Y., Nucifora G. RT Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles. RL J. Biol. Chem. 276:44936-43 (2001). RN [6]; RE0037431. RX PUBMED: 10675335. RA Martinez-Balbas M. A., Bauer U. M., Nielsen S. J., Brehm A., Kouzarides T. RT Regulation of E2F1 activity by acetylation RL EMBO J. 19:662-71 (2000). RN [7]; RE0042632. RX PUBMED: 10025406. RA Hamamori Y., Sartorelli V., Ogryzko V., Puri P. L., Wu H. Y., Wang J. Y., Nakatani Y., Kedes L. RT Regulation of histone acetyltransferases p300 and PCAF by the bHLH protein twist and adenoviral oncoprotein E1A RL Cell 96:405-13 (1999). RN [8]; RE0047694. RX PUBMED: 14769800. RA Jin Y., Zeng S. X., Lee H., Lu H. RT MDM2 mediates p300/CREB-binding protein-associated factor ubiquitination and degradation. RL J. Biol. Chem. 279:20035-20043 (2004). RN [9]; RE0048066. RX PUBMED: 12887892. RA Fulco M., Schiltz R. L., Iezzi S., King M. T., Zhao P., Kashiwaya Y., Hoffman E., Veech R. L., Sartorelli V. RT Sir2 regulates skeletal muscle differentiation as a potential sensor of the redox state. RL Mol. Cell 12:51-62 (2003). RN [10]; RE0048072. RX PUBMED: 12529406. RA Yamagoe S., Kanno T., Kanno Y., Sasaki S., Siegel R. M., Lenardo M. J., Humphrey G., Wang Y., Nakatani Y., Howard B. H., Ozato K. RT Interaction of histone acetylases and deacetylases in vivo. RL Mol. Cell. Biol. 23:1025-1033 (2003). RN [11]; RE0048190. RX PUBMED: 15572685. RA Patel J. H., Du Y., Ard P. G., Phillips C., Carella B., Chen C. J., Rakowski C., Chatterjee C., Lieberman P. M., Lane W. S., Blobel G. A., McMahon S. B. RT The c-MYC oncoprotein is a substrate of the acetyltransferases hGCN5/PCAF and TIP60. RL Mol. Cell. Biol. 24:10826-10834 (2004). RN [12]; RE0048289. RX PUBMED: 10022868. RA Masumi A., Wang I. M., Lefebvre B., Yang X. J., Nakatani Y., Ozato K. RT The histone acetylase PCAF is a phorbol-ester-inducible coactivator of the IRF family that confers enhanced interferon responsiveness. RL Mol. Cell. Biol. 19:1810-1820 (1999). RN [13]; RE0048797. RX PUBMED: 11279135. RA Wang C., Fu M., Angeletti R. H., Siconolfi-Baez L., Reutens A. T., Albanese C., Lisanti M. P., Katzenellenbogen B. S., Kato S., Hopp T., Fuqua S. A., Lopez G. N., Kushner P. J., Pestell R. G. RT Direct acetylation of the estrogen receptor alpha hinge region by p300 regulates transactivation and hormone sensitivity. RL J. Biol. Chem. 276:18375-18383 (2001). RN [14]; RE0050138. RX PUBMED: 17293853. RA Linares L. K., Kiernan R., Triboulet R., Chable-Bessia C., Latreille D., Cuvier O., Lacroix M., Le Cam L., Coux O., Benkirane M. RT Intrinsic ubiquitination activity of PCAF controls the stability of the oncoprotein Hdm2. RL Nat. Cell Biol. 9:331-338 (2007). RN [15]; RE0052561. RX PUBMED: 11285237. RA Mal A., Sturniolo M., Schiltz R. L., Ghosh M. K., Harter M. L. RT A role for histone deacetylase HDAC1 in modulating the transcriptional activity of MyoD: inhibition of the myogenic program. RL EMBO J. 20:1739-1753 (2001). XX //