TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08487 XX ID T08487 XX DT 27.01.2006 (created); din. DT 19.10.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA AR-isoform1 XX SY androgen receptor; AR; dihydrotestosterone receptor; NR3C4. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004953 AR; HGNC: AR. XX CL C0002; CC (rec); 2.1.1.1.4.2. XX SZ 919 AA; 99.0 kDa (cDNA) (calc.), 110-112 kDa (SDS) [59] XX SQ MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ SQ QQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSA SQ LECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLK SQ DILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKA SQ VSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKS SQ TEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSR SQ DYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGP SQ GSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPY SQ GYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLE SQ TARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRND SQ CTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLT SQ VSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAK SQ ALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRM SQ YSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDR SQ IIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIIS SQ VQVPKILSGKVKPIYFHTQ XX SC translated from EMBL:M20132 XX FT 6 447 PF02166; Androgen receptor. FT 141 827 PF00478; IMP dehydrogenase / GMP reductase doma. FT 556 627 SM00399; c4gold. FT 556 631 PS51030; NUCLEAR_REC_DBD_2. FT 557 632 PF00105; Zinc finger, C4 type (two domains). FT 622 919 ligand binding domain [7]. FT 706 870 SM00430; holi. FT 709 894 PF00104; Ligand-binding domain of nuclear hormo. FT 890 904 AF-2 domain (transactivation activity) [58]. XX IN T15601 AR; Mammalia. IN T14095 ATF-3; Mammalia. IN T22423 BAF57-isoform1; human, Homo sapiens. IN T15204 brca1; Mammalia. IN T05451 BRG1; human, Homo sapiens. IN T15118 CBP; Mammalia. IN T08470 Daxx-isoform1; human, Homo sapiens. IN T33929 DRIP205-isoform1; human, Homo sapiens. IN T33762 DRIP205; human, Homo sapiens. IN T00241 Egr-1; human, Homo sapiens. IN T10531 Egr-1; Mammalia. IN T08445 Elk1-isoform1; human, Homo sapiens. IN T04106 HDAC1; human, Homo sapiens. IN T08343 HDAC1; human, Homo sapiens. IN T21852 HDAC1; Mammalia. IN T23099 Hey1; Mammalia. IN T00992 Hsp90; human, Homo sapiens. IN T05110 Ku70; human, Homo sapiens. IN T32445 Ku70; Mammalia. IN T05111 Ku80; human, Homo sapiens. IN T32444 Ku80; Mammalia. IN T08861 NCOR1-isoform1; human, Homo sapiens. IN T04687 NCOR1; human, Homo sapiens. IN T06148 p/CAF; human, Homo sapiens. IN T25811 p107-isoform1; human, Homo sapiens. IN T21984 p300; human, Homo sapiens. IN T23091 p300; Mammalia. IN T14055 PARP; human, Homo sapiens. IN T28752 RPB1; human, Homo sapiens. IN T23084 SHP; Mammalia. IN T30231 SIRT1-isoform1; human, Homo sapiens. IN T04096 Smad3-isoform1; human, Homo sapiens. IN T08326 Sp1; Mammalia. IN T04632 SRC-1; human, Homo sapiens. IN T08256 SRC-1A; human, Homo sapiens. IN T04640 SRC3; human, Homo sapiens. IN T14458 STAT3; Mammalia. IN T09961 TFIIF-alpha; human, Homo sapiens. IN T09962 TFIIF-beta; human, Homo sapiens. IN T09156 TGIF-isoform2; human, Homo sapiens. IN T02483 TIF2; human, Homo sapiens. IN T09133 YY1; Mammalia. XX MX M00481 V$AR_01. MX M00953 V$AR_02. MX M00956 V$AR_03. MX M01201 V$AR_04. MX M08907 V$AR_13. MX M08908 V$AR_14_H. MX M00447 V$AR_Q2. MX M00962 V$AR_Q6. MX M01996 V$AR_Q6_01. XX BS R10326. BS R10327. BS R10328. BS R10329. BS R14259. BS R14281. BS R14282. BS R14283. BS R14284. BS R14262. BS R14263. BS R14264. BS R14265. BS R14266. BS R14267. BS R24793. BS R24798. BS R24800. BS R14294. BS R14295. BS R14296. BS R14297. BS R14306. BS R14276. BS R10144. BS R10148. BS R10149. BS R10150. BS R10151. BS R10152. BS R14314. BS R14299. BS R14300. BS R14260. XX DR TRANSPATH: MO000058849. DR EMBL: M20132; HSANDREC. DR UniProtKB: P10275-1; XX RN [1]; RE0003758. RX PUBMED: 1985913. RA Simental J. A., Sar M., Lane M. V., French F. S., Wilsion E. RT Transcriptional activation and nuclear targeting signals of the human androgen receptor RL J. Biol. Chem. 266:510-518 (1991). RN [2]; RE0003761. RX PUBMED: 8175737. RA Zhou Z.-x., Sar M., Simantal J. A., Lane M. V., Wilson E. M. RT A ligand-dependent bipartite nuclear targeting signal in the human androgen receptor RL J. Biol. Chem. 269:13115-13123 (1994). RN [3]; RE0027318. RX PUBMED: 11121022. RA Poukka H., Karvonen U., Janne O. A., Palvimo J. J. RT Covalent modification of the androgen receptor by small ubiquitin-like modifier 1 (SUMO-1) RL Proc. Natl. Acad. Sci. USA 97:14145-50 (2000). RN [4]; RE0029026. RX PUBMED: 11682623. RA Sharma M., Sun Z. RT 5'TG3' interacting factor interacts with Sin3A and represses AR-mediated transcription. RL Mol. Endocrinol. 15:1918-28 (2001). RN [5]; RE0029221. RX PUBMED: 9238003. RA McEwan I. J., Gustafsson J. RT Interaction of the human androgen receptor transactivation function with the general transcription factor TFIIF. RL Proc. Natl. Acad. Sci. USA 94:8485-90 (1997). RN [6]; RE0029628. RX PUBMED: 11994312. RA Gaughan L., Logan I. R., Cook S., Neal D. E., Robson C. N. RT Tip60 and histone deacetylase 1 regulate androgen receptor activity through changes to the acetylation status of the receptor. RL J. Biol. Chem. 277:25904-13 (2002). RN [7]; RE0029988. RX PUBMED: 12218053. RA Wang Q., Sharma D., Ren Y., Fondell J. D. RT A coregulatory role for the TRAP-mediator complex in androgen receptor-mediated gene expression. RL J. Biol. Chem. 277:42852-8 (2002). RN [8]; RE0030408. RX PUBMED: 12771131. RA Agoulnik I. U., Krause W. C., Bingman W. E. 3rd, Rahman H. T., Amrikachi M., Ayala G. E., Weigel N. L. RT Repressors of androgen and progesterone receptor action. RL J. Biol. Chem. 278:31136-48 (2003). RN [9]; RE0031300. RX PUBMED: 12177000. RA Nishida T., Yasuda H. RT PIAS1 and PIASxalpha function as SUMO-E3 ligases toward androgen receptor and repress androgen receptor-dependent transcription. RL J. Biol. Chem. 277:41311-7 (2002). RN [10]; RE0037971. RX PUBMED: 12077349. RA Kotaja N., Karvonen U., Janne O. A., Palvimo J. J. RT PIAS proteins modulate transcription factors by functioning as SUMO-1 ligases RL Mol. Cell. Biol. 22:5222-34 (2002). RN [11]; RE0041249. RX PUBMED: 14981544. RA Gross M., Yang R., Top I., Gasper C., Shuai K. RT PIASy-mediated repression of the androgen receptor is independent of sumoylation RL Oncogene 23:3059-66 (2004). RN [12]; RE0041560. RX PUBMED: 12804609. RA Yamamoto T., Sato N., Sekine Y., Yumioka T., Imoto S., Junicho A., Fuse H., Matsuda T. RT Molecular interactions between STAT3 and protein inhibitor of activated STAT3, and androgen receptor RL Biochem. Biophys. Res. Commun. 306:610-5 (2003). RN [13]; RE0041684. RX PUBMED: 12682292. RA Loy C. J., Sim K. S., Yong E. L. RT Filamin-A fragment localizes to the nucleus to regulate androgen receptor and coactivator functions RL Proc. Natl. Acad. Sci. USA 100:4562-7 (2003). RN [14]; RE0044905. RX PUBMED: 11773441. RA Lee S. R., Ramos S. M., Ko A., Masiello D., Swanson K. D., Lu M. L., Balk S. P. RT AR and ER interaction with a p21-activated kinase (PAK6) RL Mol. Endocrinol. 16:85-99 (2002). RN [15]; RE0047163. RX PUBMED: 14612401. RA Fu M., Rao M., Wang C., Sakamaki T., Wang J., Di Vizio D., Zhang X., Albanese C., Balk S., Chang C., Fan S., Rosen E., Palvimo J. J., Janne O. A., Muratoglu S., Avantaggiati M. L., Pestell R. G. RT Acetylation of androgen receptor enhances coactivator binding and promotes prostate cancer cell growth RL Mol. Cell. Biol. 23:8563-75 (2003). RN [16]; RE0047189. RX PUBMED: 15062576. RA Dotzlaw H., Papaioannou M., Moehren U., Claessens F., Baniahmad A. RT Agonist-antagonist induced coactivator and corepressor interplay on the human androgen receptor RL Mol. Cell. Endocrinol. 213:79-85 (2003). RN [17]; RE0047715. RX PUBMED: 11266503. RA Zilliacus J., Holter E., Wakui H., Tazawa H., Treuter E., Gustafsson J. A. RT Regulation of glucocorticoid receptor activity by 14--3-3-dependent intracellular relocalization of the corepressor RIP140. RL Mol. Endocrinol. 15:501-511 (2001). RN [18]; RE0047840. RX PUBMED: 16725394. RA Rees I., Lee S., Kim H., Tsai F. T. RT The E3 ubiquitin ligase CHIP binds the androgen receptor in a phosphorylation-dependent manner. RL Biochim. Biophys. Acta 1764:1073-1079 (2006). RN [19]; RE0047901. RX PUBMED: 15640443. RA Gaughan L., Logan I. R., Neal D. E., Robson C. N. RT Regulation of androgen receptor and histone deacetylase 1 by Mdm2-mediated ubiquitylation. RL Nucleic Acids Res. 33:13-26 (2005). RN [20]; RE0048010. RX PUBMED: 14684849. RA Black B. E., Vitto M. J., Gioeli D., Spencer A., Afshar N., Conaway M. R., Weber M. J., Paschal B. M. RT Transient, ligand-dependent arrest of the androgen receptor in subnuclear foci alters phosphorylation and coactivator interactions. RL Mol. Endocrinol. 18:834-850 (2004). RN [21]; RE0048185. RX PUBMED: 10709768. RA Yeh S., Kang H. Y., Miyamoto H., Nishimura K., Chang H. C., Ting H. J., Rahman M., Lin H. K., Fujimoto N., Hu Y. C., Mizokami A., Huang K. E., Chang C. RT Differential induction of androgen receptor transactivation by different androgen receptor coactivators in human prostate cancer DU145 cells. RL Endocrine 11:195-202 (1999). RN [22]; RE0048210. RX PUBMED: 15988012. RA Chen Y. H., Kim J. H., Stallcup M. R. RT GAC63, a GRIP1-dependent nuclear receptor coactivator. RL Mol. Cell. Biol. 25:5965-5972 (2005). RN [23]; RE0048216. RX PUBMED: 16368182. RA Faus H., Meyer H. A., Huber M., Bahr I., Haendler B. RT The ubiquitin-specific protease USP10 modulates androgen receptor function. RL Mol. Cell. Endocrinol. 245:138-146 (2005). RN [24]; RE0048231. RX PUBMED: 16212558. RA Domanskyi A., Virtanen K. T., Palvimo J. J., Janne O. A. RT Biochemical characterization of androgen receptor-interacting protein 4. RL Biochem. J. 393:789-795 (2006). RN [25]; RE0048243. RX PUBMED: 16914734. RA Logan I. R., Gaughan L., McCracken S. R., Sapountzi V., Leung H. Y., Robson C. N. RT Human PIRH2 enhances androgen receptor signaling through inhibition of histone deacetylase 1 and is overexpressed in prostate cancer. RL Mol. Cell. Biol. 26:6502-6510 (2006). RN [26]; RE0048268. RX PUBMED: 16282370. RA Gioeli D., Black B. E., Gordon V., Spencer A., Kesler C. T., Eblen S. T., Paschal B. M., Weber M. J. RT Stress kinase signaling regulates androgen receptor phosphorylation, transcription, and localization. RL Mol. Endocrinol. 20:503-515 (2006). RN [27]; RE0048328. RX PUBMED: 16254014. RA Khan O. Y., Fu G., Ismail A., Srinivasan S., Cao X., Tu Y., Lu S., Nawaz Z. RT Multifunction steroid receptor coactivator, E6-associated protein, is involved in development of the prostate gland. RL Mol. Endocrinol. 20:544-559 (2006). RN [28]; RE0048348. RX PUBMED: 9892017. RA Alen P., Claessens F., Schoenmakers E., Swinnen J. V., Verhoeven G., Rombauts W., Peeters B. RT Interaction of the putative androgen receptor-specific coactivator ARA70/ELE1alpha with multiple steroid receptors and identification of an internally deleted ELE1beta isoform. RL Mol. Endocrinol. 13:117-128 (1999). RN [29]; RE0048366. RX PUBMED: 16373397. RA Li J., Fu J., Toumazou C., Yoon H. G., Wong J. RT A role of the amino-terminal (N) and carboxyl-terminal (C) interaction in binding of androgen receptor to chromatin. RL Mol. Endocrinol. 20:776-785 (2006). RN [30]; RE0048534. RX PUBMED: 16051670. RA Huang C. Y., Beliakoff J., Li X., Lee J., Li X., Sharma M., Lim B., Sun Z. RT hZimp7, a novel PIAS-like protein, enhances androgen receptor-mediated transcription and interacts with SWI/SNF-like BAF complexes. RL Mol. Endocrinol. 19:2915-2929 (2005). RN [31]; RE0048539. RX PUBMED: 15572661. RA Lin D. Y., Fang H. I., Ma A. H., Huang Y. S., Pu Y. S., Jenster G., Kung H. J., Shih H. M. RT Negative modulation of androgen receptor transcriptional activity by Daxx. RL Mol. Cell. Biol. 24:10529-10541 (2004). RN [32]; RE0048561. RX PUBMED: 15640154. RA Mayeur G. L., Kung W. J., Martinez A., Izumiya C., Chen D. J., Kung H. J. RT Ku is a novel transcriptional recycling coactivator of the androgen receptor in prostate cancer cells. RL J. Biol. Chem. 280:10827-10833 (2005). RN [33]; RE0048591. RX PUBMED: 16951154. RA Ma A. H., Xia L., Desai S. J., Boucher D. L., Guan Y., Shih H. M., Shi X. B., Devere White R. W., Chen H. W., Tepper C. G., Kung H. J. RT Male Germ Cell-Associated Kinase, a Male-Specific Kinase Regulated by Androgen, Is a Coactivator of Androgen Receptor in Prostate Cancer Cells. RL Cancer Res. 66:8439-8447 (2006). RN [34]; RE0048872. RX PUBMED: 15882980. RA Ishizuka M., Kawate H., Takayanagi R., Ohshima H., Tao R. H., Hagiwara H. RT A zinc finger protein TZF is a novel corepressor of androgen receptor. RL Biochem. Biophys. Res. Commun. 331:1025-1031 (2005). RN [35]; RE0048904. RX PUBMED: 15743818. RA Link K. A., Burd C. J., Williams E., Marshall T., Rosson G., Henry E., Weissman B., Knudsen K. E. RT BAF57 governs androgen receptor action and androgen-dependent proliferation through SWI/SNF. RL Mol. Cell. Biol. 25:2200-2215 (2005). RN [36]; RE0048918. RX PUBMED: 14664704. RA Betney R., McEwan I. J. RT Role of conserved hydrophobic amino acids in androgen receptor AF-1 function. RL J. Mol. Endocrinol. 31:427-439 (2003). RN [37]; RE0048965. RX PUBMED: 15598662. RA Hodgson M. C., Astapova I., Cheng S., Lee L. J., Verhoeven M. C., Choi E., Balk S. P., Hollenberg A. N. RT The androgen receptor recruits nuclear receptor CoRepressor (N-CoR) in the presence of mifepristone via its N and C termini revealing a novel molecular mechanism for androgen receptor antagonists. RL J. Biol. Chem. 280:6511-6519 (2005). RN [38]; RE0049003. RX PUBMED: 12890669. RA Yang S. Z., Abdulkadir S. A. RT Early growth response gene 1 modulates androgen receptor signaling in prostate carcinoma cells. RL J. Biol. Chem. 278:39906-39911 (2003). RN [39]; RE0049041. RX PUBMED: 11682622. RA Curtin D., Jenkins S., Farmer N., Anderson A. C., Haisenleder D. J., Rissman E., Wilson E. M., Shupnik M. A. RT Androgen suppression of GnRH-stimulated rat LHbeta gene transcription occurs through Sp1 sites in the distal GnRH-responsive promoter region. RL Mol. Endocrinol. 15:1906-1917 (2001). RN [40]; RE0049151. RX PUBMED: 16361251. RA Zheng Z., Cai C., Omwancha J., Chen S. Y., Baslan T., Shemshedini L. RT SUMO-3 enhances androgen receptor transcriptional activity through a sumoylation-independent mechanism in prostate cancer cells. RL J. Biol. Chem. 281:4002-4012 (2006). RN [41]; RE0049192. RX PUBMED: 12015328. RA Gioeli D., Ficarro S. B., Kwiek J. J., Aaronson D., Hancock M., Catling A. D., White F. M., Christian R. E., Settlage R. E., Shabanowitz J., Hunt D. F., Weber M. J. RT Androgen receptor phosphorylation. Regulation and identification of the phosphorylation sites. RL J. Biol. Chem. 277:29304-29314 (2002). RN [42]; RE0049242. RX PUBMED: 16923962. RA Fu M., Liu M., Sauve A. A., Jiao X., Zhang X., Wu X., Powell M. J., Yang T., Gu W., Avantaggiati M. L., Pattabiraman N., Pestell T. G., Wang F., Quong A. A., Wang C., Pestell R. G. RT Hormonal control of androgen receptor function through SIRT1. RL Mol. Cell. Biol. 26:8122-8135 (2006). RN [43]; RE0049315. RX PUBMED: 11322786. RA Matsuda T., Junicho A., Yamamoto T., Kishi H., Korkmaz K., Saatcioglu F., Fuse H., Muraguchi A. RT Cross-talk between signal transducer and activator of transcription 3 and androgen receptor signaling in prostate carcinoma cells. RL Biochem. Biophys. Res. Commun. 283:179-187 (2001). RN [44]; RE0049344. RX PUBMED: 16027218. RA Mills I. G., Gaughan L., Robson C., Ross T., McCracken S., Kelly J., Neal D. E. RT Huntingtin interacting protein 1 modulates the transcriptional activity of nuclear hormone receptors. RL J. Cell Biol. 170:191-200 (2005). RN [45]; RE0049346. RX PUBMED: 17043241. RA Chen S., Xu Y., Yuan X., Bubley G. J., Balk S. P. RT Androgen receptor phosphorylation and stabilization in prostate cancer by cyclin-dependent kinase 1. RL Proc. Natl. Acad. Sci. USA 103:15969-15974 (2006). RN [46]; RE0049351. RX PUBMED: 17192406. RA Nair S. S., Guo Z., Mueller J. M., Koochekpour S., Qiu Y., Tekmal R. R., Schule R., Kung H. J., Kumar R., Vadlamudi R. K. RT PELP1/MNAR enhances androgen receptor functions through LIM-only coactivator FHL2. RL Mol. Endocrinol. 21:613-624 (2007). RN [47]; RE0049358. RX PUBMED: 17082327. RA Yang Z., Chang Y. J., Miyamoto H., Ni J., Niu Y., Chen Z., Chen Y. L., Yao J. L., di Sant'Agnese P. A., Chang C. RT Transgelin functions as a suppressor via inhibition of ARA54-enhanced androgen receptor transactivation and prostate cancer cell growth. RL Mol. Endocrinol. 21:343-358 (2007). RN [48]; RE0049364. RX PUBMED: 16527872. RA Carascossa S., Gobinet J., Georget V., Lucas A., Badia E., Castet A., White R., Nicolas J. C., Cavailles V., Jalaguier S. RT Receptor-interacting protein 140 is a repressor of the androgen receptor activity. RL Mol. Endocrinol. 20:1506-1518 (2006). RN [49]; RE0049770. RX PUBMED: 15684393. RA Belandia B., Powell S. M., Garcia-Pedrero J. M., Walker M. M., Bevan C. L., Parker M. G. RT Hey1, a mediator of notch signaling, is an androgen receptor corepressor. RL Mol. Cell. Biol. 25:1425-1436 (2005). RN [50]; RE0050336. RX PUBMED: 17587566. RA Meyer R., Wolf S. S., Obendorf M. RT PRMT2, a member of the protein arginine methyltransferase family, is a coactivator of the androgen receptor. RL J. Steroid Biochem. Mol. Biol. 107:1-14 (2007). RN [51]; RE0050438. RX PUBMED: 17555712. RA Shin S., Janknecht R. RT Activation of androgen receptor by histone demethylases JMJD2A and JMJD2D. RL Biochem. Biophys. Res. Commun. 359:742-746 (2007). RN [52]; RE0053397. RX PUBMED: 14662770. RA Gregory C. W., Fei X., Ponguta L. A., He B., Bill H. M., French F. S., Wilson E. M. RT Epidermal growth factor increases coactivation of the androgen receptor in recurrent prostate cancer. RL J. Biol. Chem. 279:7119-7130 (2004). RN [53]; RE0053553. RX PUBMED: 11085509. RA Park J. J., Irvine R. A., Buchanan G., Koh S. S., Park J. M., Tilley W. D., Stallcup M. R., Press M. F., Coetzee G. A. RT Breast cancer susceptibility gene 1 (BRCAI) is a coactivator of the androgen receptor. RL Cancer Res. 60:5946-5949 (2000). RN [54]; RE0053600. RX PUBMED: 15066986. RA Hinkle C. L., Sunnarborg S. W., Loiselle D., Parker C. E., Stevenson M., Russell W. E., Lee D. C. RT Selective roles for tumor necrosis factor alpha-converting enzyme/ADAM17 in the shedding of the epidermal growth factor receptor ligand family: the juxtamembrane stalk determines cleavage efficiency. RL J. Biol. Chem. 279:24179-24188 (2004). RN [55]; RE0064025. RX PUBMED: 18511414. RA Ponguta L. A., Gregory C. W., French F. S., Wilson E. M. RT Site-specific androgen receptor serine phosphorylation linked to epidermal growth factor-dependent growth of castration-recurrent prostate cancer. RL J. Biol. Chem. 283:20989-21001 (2008). RN [56]; RE0064360. RX PUBMED: 17591767. RA Askew E. B., Gampe RT J. r., Stanley T. B., Faggart J. L., Wilson E. M. RT Modulation of androgen receptor activation function 2 by testosterone and dihydrotestosterone. RL J. Biol. Chem. 282:25801-25816 (2007). RN [57]; RE0073074. RX PUBMED: 22102282. RA Jin F., Claessens F., Fondell J. D. RT Regulation of androgen receptor-dependent transcription by coactivator MED1 is mediated through a newly discovered noncanonical binding motif. RL J. Biol. Chem. 287:858-870 (2012). RN [58]; RE0016449. RX PUBMED: 10428842. RA Hong H., Yang L., Stallcup M. R. RT Hormone-independent transcriptional activation and coactivator binding by novel orphan nuclear receptor ERR3 RL J. Biol. Chem. 274:22618-22626 (1999). RN [59]; RE0003757. RX PUBMED: 1775129. RA Jenster G., van der Korput H. A. G. M., van Vroonhoven C., van der Kwast T. H., Trapman J., Brinkmann A. O. RT Domains of the human androgen receptor involved in steroid binding, transcriptional activation, and subcellular localization RL Mol. Endocrinol. 5:1396-1404 (1991). XX //