TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09962 XX ID T09962 XX DT 29.11.2006 (created); din. DT 29.11.2006 (updated); din. CO Copyright (C), QIAGEN. XX FA TFIIF-beta XX SY RAP30. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003986 GTF2F2; HGNC: GTF2F2. XX SZ 249 AA; 28.4 kDa (cDNA) (calc.), 30 kDa (SDS) [6] XX SQ MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE SQ DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA SQ SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK SQ QHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR SQ HYQGEEKSD XX SC Swiss-Prot#P13984 XX FT 1 110 interaction with TFIIF-alpha [9]. FT 4 249 PF02270; Transcription initiation factor IIF, beta. FT 162 244 cryptic DNA-binding [10]. XX IN T08487 AR-isoform1; human, Homo sapiens. XX DR TRANSPATH: MO000093594. DR EMBL: X16901; DR EMBL: X59745; DR UniProtKB: P13984; XX RN [1]; RE0005507. RX PUBMED: 8758937. RA Dubrovskaya V., Lavigne A.-C., Davidson I., Acker J., Staub A., Tora L. RT Distinct domains of hTAFII100 are requireed for functional interactions with transcription factor TFIIbeta (RAP30) and incorporation into the TFIID complex RL EMBO J. 15:3702-3712 (1996). RN [2]; RE0005742. RX PUBMED: 2477704. RA Sopta M., Burton Z. F., Greenblatt J. RT Structure and associated DNA-helicase activity of a general transcription initiation factor that binds to RNA polymerase II RL Nature 341:410-414 (1989). RN [3]; RE0005743. RX PUBMED: 1840667. RA Horikoshi M., Fujita H., Wang J., Takada R., Roeder R. G. RT Nucleotide and amino acid sequences of RAP30 RL Nucleic Acids Res. 19:5436-5436 (1991). RN [4]; RE0005748. RX PUBMED: 1652156. RA McCracken S., Greenblatt J. RT Related RNA polymerase-binding regions in human RAP30/74 and Escherichia coli sigma70 RL Science 253:900-902 (1991). RN [5]; RE0005749. RX PUBMED: 1946469. RA Flores O., Lu H., Killeen M., Greenblatt J., Burton Z. F., Reinberg D. RT The small subunit of transcription factor IIF recruits RNA polymerase II into the preinitiation complex RL Proc. Natl. Acad. Sci. USA 88:9999-10003 (1991). RN [6]; RE0005750. RX PUBMED: 2180931. RA Flores O., Ha I., Reinberg D. RT Factors involved in specific transcription by mammalian RNA polymerase II. Purification and subunit composition of transcription factor IIE RL J. Biol. Chem. 265:5629-5634 (1990). RN [7]; RE0005752. RX PUBMED: 1729606. RA Killeen M. T., Greenblatt J. F. RT The general transcription factor RAP30 binds to RNA polymerase II and prevents it from binding nonspecifically to DNA RL Mol. Cell. Biol. 12:30-37 (1992). RN [8]; RE0005753. RX PUBMED: 8376403. RA Chang C.-H., Kostrub C. F., Burton Z. F. RT RAP30/74 (transcription factor IIF) is required for promoter escape by RNA polymerase II RL J. Biol. Chem. 268:20482-20489 (1993). RN [9]; RE0005754. RX PUBMED: 8441635. RA Yonaha M., Aso T., Kobayashi Y., Vasavada H., Yasukochi Y., Weissman S. M., Kitajima S. RT Domain structure of a human general transcription initiation factor, TFIIF RL Nucleic Acids Res. 21:273-279 (1993). RN [10]; RE0005755. RX PUBMED: 7937895. RA Tan S., Garrett K. P., Conaway R. C., Conaway J. W. RT Cryptic DNA-binding domain in the C terminus of RNA polymerase II general transcription factor RAP30 RL Proc. Natl. Acad. Sci. USA 91:9808-9812 (1994). RN [11]; RE0029221. RX PUBMED: 9238003. RA McEwan I. J., Gustafsson J. RT Interaction of the human androgen receptor transactivation function with the general transcription factor TFIIF. RL Proc. Natl. Acad. Sci. USA 94:8485-90 (1997). XX //