AC T08343
XX
ID T08343
XX
DT 11.01.2006 (created); jma.
DT 29.09.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA HDAC1
XX
SY HD1; HDAC-1; histone deacetylase 1; RPD3L1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003819 HDAC1; HGNC: HDAC1.
XX
SZ 482 AA; 55.1 kDa (cDNA) (calc.).
XX
SQ MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
SQ AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
SQ AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
SQ DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
SQ FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
SQ GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
SQ KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SQ SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
SQ LA
XX
SC translated from EMBL #U50079
XX
FT 10 321 
PF00850; Histone deacetylase domain.
XX
IN T08487 AR-isoform1; human, Homo sapiens.
IN T34300 BCOR-isoform2; human, Homo sapiens.
IN T34301 BCOR-S; human, Homo sapiens.
IN T09429 COUP-TF2; mouse, Mus musculus.
IN T10310 COUP-TF2; Mammalia.
IN T08470 Daxx-isoform1; human, Homo sapiens.
IN T23093 EKLF; Mammalia.
IN T08291 GATA-1-isoform1; mouse, Mus musculus.
IN T01686 GCN5; human, Homo sapiens.
IN T25625 hdac2; human, Homo sapiens.
IN T08522 HDAC4-isoform1; human, Homo sapiens.
IN T09040 HNF-1beta; human, Homo sapiens.
IN T09093 ipf1; mouse, Mus musculus.
IN T10332 ipf1; Mammalia.
IN T34270 LSD1; human, Homo sapiens.
IN T25722 MIER1-isoform1; human, Homo sapiens.
IN T26379 MIER1-isoform5; human, Homo sapiens.
IN T22430 MIER1; human, Homo sapiens.
IN T05115 MTA1L1; human, Homo sapiens.
IN T06148 p/CAF; human, Homo sapiens.
IN T25008 pRb; Mammalia.
IN T08171 PSF; human, Homo sapiens.
IN T22425 RCOR1; human, Homo sapiens.
IN T10594 SHP; human, Homo sapiens.
IN T14622 sin3a; human, Homo sapiens.
IN T04096 Smad3-isoform1; human, Homo sapiens.
IN T13998 Smad4; Mammalia.
IN T00824 TFII-I; human, Homo sapiens.
IN T09151 TGIF2-isoform1; human, Homo sapiens.
XX
MX M07041 V$HDAC1_Q3.
XX
DR TRANSPATH: MO000056714.
DR SMARTDB: SB000118.
DR EMBL: AY627042; AY627042.
DR EMBL: BC000301; BC000301.
DR EMBL: D50405; HSD405.
DR EMBL: U50079;
DR UniProtKB: Q13547; HDA1_HUMAN.
XX
RN [1]; RE0014872.
RX PUBMED: 9150135.
RA Zhang Y., Iratni R., Erdjument-Bromage H., Tempst P., Reinberg D.
RT Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex
RL Cell 89:357-364 (1997).
RN [2]; RE0025559.
RX PUBMED: 10846170.
RA Cai R. L., Yan-Neale Y., Cueto M. A., Xu H., Cohen D.
RT HDAC1, a histone deacetylase, forms a complex with Hus1 and Rad9, two G2/M checkpoint Rad proteins.
RL J. Biol. Chem. 275:27909-16 (2000).
RN [3]; RE0025804.
RX PUBMED: 14668799.
RA Watamoto K., Towatari M., Ozawa Y., Miyata Y., Okamoto M., Abe A., Naoe T., Saito H.
RT Altered interaction of HDAC5 with GATA-1 during MEL cell differentiation.
RL Oncogene 22:9176-84 (2003).
RN [4]; RE0026599.
RX PUBMED: 10898795.
RA Huynh K. D., Fischle W., Verdin E., Bardwell V. J.
RT BCoR, a novel corepressor involved in BCL-6 repression.
RL Genes Dev. 14:1810-23 (2000).
RN [5]; RE0027320.
RX PUBMED: 10995736.
RA Melhuish T. A., Wotton D.
RT The interaction of the carboxyl terminus-binding protein with the smad corepressor TGIF is disrupted by a holoprosencephaly mutation in TGIF
RL J. Biol. Chem. 275:39762-6 (2000).
RN [6]; RE0028372.
RX PUBMED: 11486036.
RA Yao Y. L., Yang W. M., Seto E.
RT Regulation of transcription factor YY1 by acetylation and deacetylation.
RL Mol. Cell. Biol. 21:5979-91 (2001).
RN [7]; RE0029026.
RX PUBMED: 11682623.
RA Sharma M., Sun Z.
RT 5'TG3' interacting factor interacts with Sin3A and represses AR-mediated transcription.
RL Mol. Endocrinol. 15:1918-28 (2001).
RN [8]; RE0029293.
RX PUBMED: 11804585.
RA Fischle W., Dequiedt F., Hendzel M. J., Guenther M. G., Lazar M. A., Voelter W., Verdin E.
RT Enzymatic activity associated with class II HDACs is dependent on a multiprotein complex containing HDAC3 and SMRT/N-CoR.
RL Mol. Cell 9:45-57 (2002).
RN [9]; RE0029628.
RX PUBMED: 11994312.
RA Gaughan L., Logan I. R., Cook S., Neal D. E., Robson C. N.
RT Tip60 and histone deacetylase 1 regulate androgen receptor activity through changes to the acetylation status of the receptor.
RL J. Biol. Chem. 277:25904-13 (2002).
RN [10]; RE0037667.
RX PUBMED: 12202768.
RA Deplus R., Brenner C., Burgers W. A., Putmans P., Kouzarides T., de Launoit Y., Fuks F.
RT Dnmt3L is a transcriptional repressor that recruits histone deacetylase
RL Nucleic Acids Res. 30:3831-8 (2002).
RN [11]; RE0041454.
RX PUBMED: 10704340.
RA Smirnov D. A., Hou S., Ricciardi R. P.
RT Association of histone deacetylase with COUP-TF in tumorigenic Ad12-transformed cells and its potential role in shut-off of MHC class I transcription
RL Virology 268:319-28 (2000).
RN [12]; RE0041859.
RX PUBMED: 11306568.
RA Liberati N. T., Moniwa M., Borton A. J., Davie J. R., Wang X. F.
RT An essential role for Mad homology domain 1 in the association of Smad3 with histone deacetylase activity*
RL J. Biol. Chem. 276:22595-603 (2001).
RN [13]; RE0047888.
RX PUBMED: 15496408.
RA Mosley A. L., Ozcan S.
RT The pancreatic duodenal homeobox-1 protein (Pdx-1) interacts with histone deacetylases Hdac-1 and Hdac-2 on low levels of glucose.
RL J. Biol. Chem. 279:54241-54247 (2004).
RN [14]; RE0047909.
RX PUBMED: 12482978.
RA Ding Z., Gillespie L. L., Paterno G. D.
RT Human MI-ER1 alpha and beta function as transcriptional repressors by recruitment of histone deacetylase 1 to their conserved ELM2 domain.
RL Mol. Cell. Biol. 23:250-258 (2003).
RN [15]; RE0047925.
RX PUBMED: 11427533.
RA Melhuish T. A., Gallo C. M., Wotton D.
RT TGIF2 interacts with histone deacetylase 1 and represses transcription.
RL J. Biol. Chem. 276:32109-32114 (2001).
RN [16]; RE0047936.
RX PUBMED: 10669754.
RA Li H., Leo C., Zhu J., Wu X., O'Neil J., Park E. J., Chen J. D.
RT Sequestration and inhibition of Daxx-mediated transcriptional repression by PML.
RL Mol. Cell. Biol. 20:1784-1796 (2000).
RN [17]; RE0048042.
RX PUBMED: 15542849.
RA Chen X., Bieker J. J.
RT Stage-specific repression by the EKLF transcriptional activator.
RL Mol. Cell. Biol. 24:10416-10424 (2004).
RN [18]; RE0048072.
RX PUBMED: 12529406.
RA Yamagoe S., Kanno T., Kanno Y., Sasaki S., Siegel R. M., Lenardo M. J., Humphrey G., Wang Y., Nakatani Y., Howard B. H., Ozato K.
RT Interaction of histone acetylases and deacetylases in vivo.
RL Mol. Cell. Biol. 23:1025-1033 (2003).
RN [19]; RE0048939.
RX PUBMED: 16731528.
RA Zhong N., Kim C. Y., Rizzu P., Geula C., Porter D. R., Pothos E. N., Squitieri F., Heutink P., Xu J.
RT DJ-1 transcriptionally up-regulates the human tyrosine hydroxylase by inhibiting the sumoylation of pyrimidine tract-binding protein-associated splicing factor.
RL J. Biol. Chem. 281:20940-20948 (2006).
RN [20]; RE0049206.
RX PUBMED: 16478987.
RA Bhakat K. K., Mokkapati S. K., Boldogh I., Hazra T. K., Mitra S.
RT Acetylation of human 8-oxoguanine-DNA glycosylase by p300 and its role in 8-oxoguanine repair in vivo.
RL Mol. Cell. Biol. 26:1654-1665 (2006).
RN [21]; RE0051864.
RX PUBMED: 17000776.
RA Liu Y., Smith P. W., Jones D. R.
RT Breast cancer metastasis suppressor 1 functions as a corepressor by enhancing histone deacetylase 1-mediated deacetylation of RelA/p65 and promoting apoptosis.
RL Mol. Cell. Biol. 26:8683-8696 (2006).
RN [22]; RE0052069.
RX PUBMED: 12242305.
RA Zhang C. L., McKinsey T. A., Olson E. N.
RT Association of class II histone deacetylases with heterochromatin protein 1: potential role for histone methylation in control of muscle differentiation.
RL Mol. Cell. Biol. 22:7302-7312 (2002).
RN [23]; RE0052206.
RX PUBMED: 12082111.
RA Tsai S. C., Seto E.
RT Regulation of histone deacetylase 2 by protein kinase CK2.
RL J. Biol. Chem. 277:31826-31833 (2002).
RN [24]; RE0052309.
RX PUBMED: 10490602.
RA Lai A., Lee J. M., Yang W. M., DeCaprio J. A., Kaelin WG J. r., Seto E., Branton P. E.
RT RBP1 recruits both histone deacetylase-dependent and -independent repression activities to retinoblastoma family proteins.
RL Mol. Cell. Biol. 19:6632-6641 (1999).
RN [25]; RE0052991.
RX PUBMED: 15509593.
RA Barbacci E., Chalkiadaki A., Masdeu C., Haumaitre C., Lokmane L., Loirat C., Cloarec S., Talianidis I., Bellanne-Chantelot C., Cereghini S.
RT HNF1beta/TCF2 mutations impair transactivation potential through altered co-regulator recruitment.
RL Hum. Mol. Genet. 13:3139-3149 (2004).
RN [26]; RE0055392.
RX PUBMED: 15550569.
RA Boulias K., Talianidis I.
RT Functional role of G9a-induced histone methylation in small heterodimer partner-mediated transcriptional repression.
RL Nucleic Acids Res. 32:6096-6103 (2004).
XX
//