TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08470 XX ID T08470 XX DT 24.01.2006 (created); ran. DT 29.04.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA Daxx-isoform1 XX SY BING2; DAP6; death-associated protein 6; hDaxx. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003519 DAXX; HGNC: DAXX. XX SZ 740 AA; 81.4 kDa (cDNA) (calc.). XX SQ MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYK SQ LENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRP SQ AKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPR SQ TRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLC SQ ELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH SQ SLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARR SQ LRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS SQ GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEE SQ DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAP SQ SSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTV SQ LENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG SQ KKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTC SQ KTSVATQCDPEEIIVLSDSD XX SC translated from EMBL #AF039136 XX FT 1 740 PF03344; Daxx Family. FT 600 740 sufficient to mediate interaction with p53 T00671 [13]. XX IN T08487 AR-isoform1; human, Homo sapiens. IN T00112 c-Ets-1A; human, Homo sapiens. IN T06570 Dnmt1; human, Homo sapiens. IN T10446 GR; Mammalia. IN T08343 HDAC1; human, Homo sapiens. IN T04109 hdac2-isoform1; human, Homo sapiens. IN T04110 HDAC3; human, Homo sapiens. IN T09182 Pax-5; mouse, Mus musculus. IN T10303 Pax-5; Mammalia. IN T06377 PML; human, Homo sapiens. IN T01931 RelB; human, Homo sapiens. IN T27517 RelB; Mammalia. IN T08728 SKIP; human, Homo sapiens. IN T04292 Smad4; human, Homo sapiens. IN T13998 Smad4; Mammalia. XX DR TRANSPATH: MO000058468. DR EMBL: AB015051; DR EMBL: AF006041; DR EMBL: AF015956; DR EMBL: AF039136; DR EMBL: AF050179; DR UniProtKB: Q9UER7; XX RN [1]; RE0035890. RX PUBMED: 14637155. RA Kim Y. Y., Park B. J., Seo G. J., Lim J. Y., Lee S. M., Kimm K. C., Park C., Kim J., Park S. I. RT Long form of cellular FLICE-inhibitory protein interacts with Daxx and prevents Fas-induced JNK activation. RL Biochem. Biophys. Res. Commun. 312:426-433 (2003). RN [2]; RE0039677. RX PUBMED: 11948183. RA Lin D. Y., Shih H. M. RT Essential role of the 58-kDa microspherule protein in the modulation of Daxx-dependent transcriptional repression as revealed by nucleolar sequestration RL J. Biol. Chem. 277:25446-56 (2002). RN [3]; RE0042428. RX PUBMED: 11799127. RA Emelyanov A. V., Kovac C. R., Sepulveda M. A., Birshtein B. K. RT The interaction of Pax5 (BSAP) with Daxx can result in transcriptional activation in B cells RL J. Biol. Chem. 277:11156-64 (2002). RN [4]; RE0047936. RX PUBMED: 10669754. RA Li H., Leo C., Zhu J., Wu X., O'Neil J., Park E. J., Chen J. D. RT Sequestration and inhibition of Daxx-mediated transcriptional repression by PML. RL Mol. Cell. Biol. 20:1784-1796 (2000). RN [5]; RE0048539. RX PUBMED: 15572661. RA Lin D. Y., Fang H. I., Ma A. H., Huang Y. S., Pu Y. S., Jenster G., Kung H. J., Shih H. M. RT Negative modulation of androgen receptor transcriptional activity by Daxx. RL Mol. Cell. Biol. 24:10529-10541 (2004). RN [6]; RE0048574. RX PUBMED: 12150977. RA Jang M. S., Ryu S. W., Kim E. RT Modification of Daxx by small ubiquitin-related modifier-1. RL Biochem. Biophys. Res. Commun. 295:495-500 (2002). RN [7]; RE0048595. RX PUBMED: 16982744. RA Croxton R., Puto L. A., de Belle I., Thomas M., Torii S., Hanaii F., Cuddy M., Reed J. C. RT Daxx represses expression of a subset of antiapoptotic genes regulated by nuclear factor-kappaB. RL Cancer Res. 66:9026-9035 (2006). RN [8]; RE0048767. RX PUBMED: 10545115. RA Torii S., Egan D. A., Evans R. A., Reed J. C. RT Human Daxx regulates Fas-induced apoptosis from nuclear PML oncogenic domains (PODs). RL EMBO J. 18:6037-6049 (1999). RN [9]; RE0048803. RX PUBMED: 15240113. RA La M., Kim K., Park J., Won J., Lee J. H., Fu Y. M., Meadows G. G., Joe C. O. RT Daxx-mediated transcriptional repression of MMP1 gene is reversed by SPOP. RL Biochem. Biophys. Res. Commun. 320:760-765 (2004). RN [10]; RE0048834. RX PUBMED: 15016915. RA Boellmann F., Guettouche T., Guo Y., Fenna M., Mnayer L., Voellmy R. RT DAXX interacts with heat shock factor 1 during stress activation and enhances its transcriptional activity. RL Proc. Natl. Acad. Sci. USA 101:4100-4105 (2004). RN [11]; RE0050232. RX PUBMED: 16524876. RA Kwon J. E., La M., Oh K. H., Oh Y. M., Kim G. R., Seol J. H., Baek S. H., Chiba T., Tanaka K., Bang O. S., Joe C. O., Chung C. H. RT BTB domain-containing speckle-type POZ protein (SPOP) serves as an adaptor of Daxx for ubiquitination by Cul3-based ubiquitin ligase. RL J. Biol. Chem. 281:12664-12672 (2006). RN [12]; RE0050498. RX PUBMED: 17081986. RA Lin D. Y., Huang Y. S., Jeng J. C., Kuo H. Y., Chang C. C., Chao T. T., Ho C. C., Chen Y. C., Lin T. P., Fang H. I., Hung C. C., Suen C. S., Hwang M. J., Chang K. S., Maul G. G., Shih H. M. RT Role of SUMO-interacting motif in Daxx SUMO modification, subnuclear localization, and repression of sumoylated transcription factors. RL Mol. Cell 24:341-354 (2006). RN [13]; RE0035196. RX PUBMED: 15339933. RA Gostissa M., Morelli M., Mantovani F., Guida E., Piazza S., Collavin L., Brancolini C., Schneider C., Del Sal G. RT The transcriptional repressor hDaxx potentiates p53-dependent apoptosis. RL J. Biol. Chem. 279:48013-48023 (2004). XX //