TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09182 XX ID T09182 XX DT 02.08.2006 (created); jul. DT 23.07.2012 (updated); pos. CO Copyright (C), QIAGEN. XX FA Pax-5 XX SY B-cell specific activator protein; BSAP; BSAP/PAX-5, B-cell Specific Activating Protein; mPax-5; mPax5; Pax-5; PAX5. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006533 Pax5. XX CL C0017; paired. XX SZ 391 AA; 42.2 kDa (cDNA) (calc.), 50 kDa (SDS) [1] XX SQ MDLEKNYPTPRTIRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV SQ SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLA SQ ERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYS SQ ISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRV SQ FERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLTSPTPADIGSSVPGPQSYP SQ IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRF SQ PNPGLLGSPYYYSPAARGAAPPAAATAYDRH XX SC Swiss-Prot#Q02650 XX FT 16 140 PF00292; 'Paired box' domain. FT 16 140 SM00351; pax3. FT 16 142 PS51057; PAIRED_2. FT 69 391 PF00478; IMP dehydrogenase / GMP reductase domain. XX IN T08470 Daxx-isoform1; human, Homo sapiens. XX MX M00143 V$PAX5_01. MX M00144 V$PAX5_02. MX M03577 V$PAX5_Q6. MX M00808 V$PAX_Q6. XX BS R17086. BS R29655. BS R08841. BS R08842. BS R29657. BS R28953. BS R16788. BS R20634. BS R37616. BS R37617. XX DR TRANSPATH: MO000084310. DR EMBL: M97013; DR UniProtKB: Q02650; XX RN [1]; RE0002744. RX PUBMED: 2116362. RA Barberis A., Widenhorn K., Vitelli L., Busslinger M. RT A novel B-cell lineage-specific transcription factor present at early but not late stages of differentiation RL Genes Dev. 4:849-859 (1990). RN [2]; RE0004022. RX PUBMED: 8001125. RA Bain G., Maandag E. C. R., Izon D. J., Amsen D., Kruisbeek A. M., Weintraub B. C., Krop I., Schlissel M. S., Feeney A. J., van Roon M., van der Falk M., te Riele H. P. J., Berns A., Murre C. RT E2A proteins are required for proper B cell development and initiation of immunoglobulin gene rearrangements RL Cell 79:885-892 (1994). RN [3]; RE0004257. RX PUBMED: 1685142. RA Walther C., Guenet J. L., Simon D., Deutsch U., Jostes B., Goulding M. D., Plachov D., Balling R., Gruss P. RT Pax: a murine multigene family of paired box-containing genes RL Genomics 11:424-434 (1991). RN [4]; RE0004263. RX PUBMED: 7739566. RA Czerny T., Busslinger M. RT DNA-binding and transactivation properties of Pax-6: three amino acids in the paired domain are responsible for the different sequence recognition of Pax-6 and BSAP (Pax-5) RL Mol. Cell. Biol. 15:2858-2871 (1995). RN [5]; RE0004279. RX PUBMED: 1516825. RA Adams B., Doerfler P., Aguzzi A., Kozmik Z., Urbanek P., Maurer-Fogy I., Busslinger M. RT Pax-5 encodes the transcription factor BSAP and is expressed in B lymphocytes, the developing CNS, and adult testis RL Genes Dev. 6:1589-1607 (1992). RN [6]; RE0004294. RX PUBMED: 8001127. RA Urbanek P., Wang Z.-Q., Fetka I., Wagner E. F., Busslinger M. RT Complete block of early B cell differentiation and altered patterning of the posterior midbrain in mice lacking Pax5/BSAP RL Cell 79:901-912 (1994). RN [7]; RE0004295. RX PUBMED: 7777508. RA Neurath M. F., Max E. E., Strober W. RT Pax5 (BSAP) regulates the mrine immunoglobulin 3'a enhancer by suppressing binding of NF-aP, a protein that controls heavy chain transcription RL Proc. Natl. Acad. Sci. USA 92:5336-5340 (1995). RN [8]; RE0014313. RX PUBMED: 8625814. RA Song D. L., Chalepakis G., Gruss P., Joyner A. L. RT Two Pax-binding sites are required for early embryonic brain expression of an Engrailed-2 transgene RL Development 122:627-635 (1996). RN [9]; RE0042428. RX PUBMED: 11799127. RA Emelyanov A. V., Kovac C. R., Sepulveda M. A., Birshtein B. K. RT The interaction of Pax5 (BSAP) with Daxx can result in transcriptional activation in B cells RL J. Biol. Chem. 277:11156-64 (2002). RN [10]; RE0047965. RX PUBMED: 10748034. RA Kovac C. R., Emelyanov A., Singh M., Ashouian N., Birshtein B. K. RT BSAP (Pax5)-importin alpha 1 (Rch1) interaction identifies a nuclear localization sequence. RL J. Biol. Chem. 275:16752-16757 (2000). XX //