AC T04109
XX
ID T04109
XX
DT 12.12.2000 (created); rio.
CO Copyright (C), QIAGEN.
XX
FA hdac2-isoform1
XX
SY HD2; hdac2; histone deacetylase 2; reduced potassium dependency 3; RPD3.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003820 HDAC2; HGNC: HDAC2.
XX
SZ 488 AA; 55.3 kDa (cDNA) (calc.).
XX
SQ MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
SQ TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMHIFNVGEDCPAFDGLFEFCQLSTGGSVA
SQ GAVKLNRQQTDMAVNWAGGLHHAKKYEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
SQ GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMCDGIDDESYGQ
SQ IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
SQ GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
SQ EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
SQ FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
SQ KSEQLSNP
XX
SC translated from EMBL #U31814
XX
FT 11 322 
PF00850; Histone deacetylase domain.
FT 32 391 
PF00478; IMP dehydrogenase / GMP reductase domai.
XX
SF interaction with YY1 T00915 increases repression activity [4] [1];
SF forms a transcriptional corepressor complex with TGIF T04076 and SMAD T04095 T04096 [3];
XX
CP ubiquitous.
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [4].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [4].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [4].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [4].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [4].
EX brain,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX heart,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX kidney (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX liver,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX lung (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX mucosa of colon,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX muscles,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX ovary (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX pancreas,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX placenta,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX prostate gland,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX small intestine,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX spleen,,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX testis (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [4].
EX thymus,,,adult; medium; Northern blot; mRNA (poly-A); [4].
XX
FF transcriptional repressor [4];
XX
IN T08470 Daxx-isoform1; human, Homo sapiens.
IN T34272 EED; human, Homo sapiens.
IN T01686 GCN5; human, Homo sapiens.
IN T09093 ipf1; mouse, Mus musculus.
IN T10332 ipf1; Mammalia.
IN T34270 LSD1; human, Homo sapiens.
IN T00490 MAZ-isoform1; human, Homo sapiens.
IN T04936 MECP-2; human, Homo sapiens.
IN T05115 MTA1L1; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T22425 RCOR1; human, Homo sapiens.
IN T14622 sin3a; human, Homo sapiens.
IN T15704 SNA; Mammalia.
IN T04076 TGIF; human, Homo sapiens.
IN T00915 YY1; human, Homo sapiens.
XX
DR TRANSPATH: MO000023577.
DR SMARTDB: SB000108.
DR EMBL: BC031055; BC031055.
DR EMBL: U31814;
DR UniProtKB: Q92769;
XX
RN [1]; RE0006424.
RX PUBMED: 8917507.
RA Yang W. M., Inouye C., Zeng Y. Y., Bearss D., Seto E.
RT Transcriptional repression by YY1 is mediated by interaction with a mammalian homolog of yeast global regulator RPD3
RL Proc. Natl. Acad. Sci. USA 93:12845-12850 (1996).
RN [2]; RE0014872.
RX PUBMED: 9150135.
RA Zhang Y., Iratni R., Erdjument-Bromage H., Tempst P., Reinberg D.
RT Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex
RL Cell 89:357-364 (1997).
RN [3]; RE0015455.
RX PUBMED: 10601270.
RA Wotton D., Lo R. S., Swaby L. A., Massague J.
RT Multiple modes of repression by the Smad transcriptional corepressor TGIF
RL J. Biol. Chem. 274:37105-37110 (1999).
RN [4]; RE0015512.
RX PUBMED: 9346952.
RA Yang W. M., Yao Y. L., Sun J. M., Davie J. R., Seto E.
RT Isolation and characterization of cDNAs corresponding to an additional member of the human histone deacetylase gene family
RL J. Biol. Chem. 272:28001-28007 (1997).
RN [5]; RE0024625.
RX PUBMED: 9620804.
RA Nan X., Ng H.-H., Johnson C. A., Laherty C. D., Turner B. M., Eisenman R. N., Bird A.
RT Transcriptional repression by the methyl-CpG-binding protein MeCP2 involves a histone deacetylase complex
RL Nature 393:386-389 (1998).
RN [6]; RE0044860.
RX PUBMED: 10581039.
RA van der Vlag J., Otte A. P.
RT Transcriptional repression mediated by the human polycomb-group protein EED involves histone deacetylation
RL Nat. Genet. 23:474-8 (1999).
RN [7]; RE0047888.
RX PUBMED: 15496408.
RA Mosley A. L., Ozcan S.
RT The pancreatic duodenal homeobox-1 protein (Pdx-1) interacts with histone deacetylases Hdac-1 and Hdac-2 on low levels of glucose.
RL J. Biol. Chem. 279:54241-54247 (2004).
RN [8]; RE0047936.
RX PUBMED: 10669754.
RA Li H., Leo C., Zhu J., Wu X., O'Neil J., Park E. J., Chen J. D.
RT Sequestration and inhibition of Daxx-mediated transcriptional repression by PML.
RL Mol. Cell. Biol. 20:1784-1796 (2000).
RN [9]; RE0048072.
RX PUBMED: 12529406.
RA Yamagoe S., Kanno T., Kanno Y., Sasaki S., Siegel R. M., Lenardo M. J., Humphrey G., Wang Y., Nakatani Y., Howard B. H., Ozato K.
RT Interaction of histone acetylases and deacetylases in vivo.
RL Mol. Cell. Biol. 23:1025-1033 (2003).
RN [10]; RE0049206.
RX PUBMED: 16478987.
RA Bhakat K. K., Mokkapati S. K., Boldogh I., Hazra T. K., Mitra S.
RT Acetylation of human 8-oxoguanine-DNA glycosylase by p300 and its role in 8-oxoguanine repair in vivo.
RL Mol. Cell. Biol. 26:1654-1665 (2006).
RN [11]; RE0052309.
RX PUBMED: 10490602.
RA Lai A., Lee J. M., Yang W. M., DeCaprio J. A., Kaelin WG J. r., Seto E., Branton P. E.
RT RBP1 recruits both histone deacetylase-dependent and -independent repression activities to retinoblastoma family proteins.
RL Mol. Cell. Biol. 19:6632-6641 (1999).
XX
//