AC T00915
XX
ID T00915
XX
DT 16.04.1993 (created); ewi.
DT 25.09.2014 (updated); yre.
CO Copyright (C), QIAGEN.
XX
FA YY1
XX
SY 62K protein; delta factor; F-ACT1; MAPF1; NF-E1 (2); NMP-1; nuclear matrix protein 1; Yin and Yang 1; YY-1; YY1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003941 YY1; HGNC: YY1.
XX
HO f-EBP, TCF [2].
XX
CL C0001; CH.
XX
SZ 414 AA; 44.8 kDa (cDNA) (calc.), 68 kDa (SDS), 62 kDa [2] [2]
XX
SQ MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
SQ GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
SQ LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
SQ GKKSYLSGGAGAAGGRGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
SQ QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
SQ KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
SQ GKRFSLDFNLKTHVKIHTGEKPYVCPFEGCNKKFAQSTNLKSHILTHAKAKNNQ
XX
SC Swiss-Prot#P25490
XX
FT 15 293 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 170 200 
HDAC2 T04109 interaction and repression domain [9].
FT 296 320 
PF00096; zf-C2H2.
FT 296 320 
PS50157; ZINC_FINGER_C2H2_2.
FT 296 320 
SM00355; c2h2final6.
FT 298 331 
Sp1 T00759 interaction domain [10].
FT 325 347 
PF00096; zf-C2H2.
FT 325 347 
SM00355; c2h2final6.
FT 325 352 
PS50157; ZINC_FINGER_C2H2_2.
FT 353 377 
PF00096; zf-C2H2.
FT 353 377 SM00355; c2h2final6.
FT 353 382 PS50157; ZINC_FINGER_C2H2_2.
FT 383 407 PF00096; zf-C2H2.
FT 383 407 SM00355; c2h2final6.
FT 383 412 PS50157; ZINC_FINGER_C2H2_2.
XX
SF 4 zinc finger motifs;
SF acidic region, H;
SF GLI family of zinc finger proteins;
SF DNA-binding depends on Me2+ ions;
SF it is identical with the nuclear matrix protein NMP-1 [8];
SF physical interaction with Sp1 T00759 [10];
SF interaction with histone deacetylases (HDACs) T04106 T04109 T04110 increases repression activity [17] [9];
XX
FF YY1 inhibits the SREBP-mediated activation of low density lipoprotein receptor (LDLR) in a sensitive and dose-dependent manner, inhibition is independently of binding directly to the LDLR;
FF YY1 inhibit the interaction between SREBP and SP1 in vitro [23];
FF activator or repressor, binds to the transcription initiation site;
FF transcription factor, look up the TRANSFAC cross reference for more details;
FF binds to the same sites as the myocyte-specific MAPF2 [3];
FF transcriptional repression relieved by action of E1A [12];
FF antagonistic to SRF by binding competition [5];
FF binding to c-fos T00123 serum response element (SRE) is essential to enhance SRF binding [13];
FF binding is not affected by CpG methylation [11];
FF induces sharp DNA bends [13];
FF association with c-Myc T00140 in vivo in a manner that depends on c-Myc levels, inhibits its activity [15];
FF binds to the DBH (dopamine beta-hydroxylase) promoter and may be involved in the regulation of the catecholamine biosynthesis [16];
FF SRF T00764 and Nkx2.5 T01675overcome YY1 repression on the alpha cardiac actin promoter [18];
FF YY1 acts as a repressor by binding to the cardiac actin SRE2 [18];
XX
IN T10136 ATF-2; human, Homo sapiens.
IN T00051 ATF; human, Homo sapiens.
IN T00053 ATFa-isoform1; human, Homo sapiens.
IN T18798 ATFa-isoform3; human, Homo sapiens.
IN T00052 ATFa-isoform6; human, Homo sapiens.
IN T00140 c-Myc-isoform1; human, Homo sapiens.
IN T04106 HDAC1; human, Homo sapiens.
IN T04109 hdac2-isoform1; human, Homo sapiens.
IN T25625 hdac2; human, Homo sapiens.
IN T04110 HDAC3; human, Homo sapiens.
IN T13873 MITF; Mammalia.
IN T01427 p300; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T14055 PARP; human, Homo sapiens.
IN T00759 Sp1; human, Homo sapiens.
IN T00782 TAFII55; human, Homo sapiens.
IN T16638 TFEA; Mammalia.
IN T02347 YAF2; human, Homo sapiens.
IN T00915 YY1; human, Homo sapiens.
XX
MX M00059 V$YY1_01.
MX M00069 V$YY1_02.
MX M02044 V$YY1_03.
MX M07370 V$YY1_Q4_01.
MX M00793 V$YY1_Q6.
MX M01035 V$YY1_Q6_02.
MX M01894 V$YY1_Q6_03.
XX
BS R03174.
BS R03175.
BS R05991.
BS R00029.
BS R00031.
BS R00034.
BS R00035.
BS R16077.
BS R16078.
BS R16079.
BS R16080.
BS R32641.
BS R00603.
BS R04957.
BS R09521.
BS R14870.
BS R00466.
BS R03113.
BS R03177.
BS R04951.
BS R04952.
BS R18414.
BS R11726.
BS R19074.
BS R34700.
BS R34703.
BS R21131.
BS R04984.
BS R04838.
BS R00472.
BS R72581.
BS R04776.
BS R00848.
BS R40093.
BS R40094.
BS R16833.
BS R37056.
BS R38725.
BS R38729.
BS R28654.
BS R01833.
BS R38999.
BS R01149.
BS R04848.
BS R04916.
BS R03321.
BS R04906.
BS R03590.
BS R04142.
BS R04143.
BS R04696.
BS R04697.
BS R19075.
XX
DR TRANSPATH: MO000025267.
DR TRANSCOMPEL: C00422.
DR TRANSCOMPEL: C00634.
DR SMARTDB: SB000031.
DR EMBL: M77698;
DR EMBL: Z14077;
DR UniProtKB: P25490;
DR PDB: 1ubd.
XX
RN [1]; RE0000230.
RX PUBMED: 1655281.
RA Shi Y., Seto E., Chang L.-S., Shenk T.
RT Transcriptional repression by YY1, a human GLI-Krueppel-related protein, and relief of repression by adenovirus E1A protein
RL Cell 67:377-388 (1991).
RN [2]; RE0000344.
RX PUBMED: 2504586.
RA Ryan jr W. A., Franza jr B. R., Gilman M. Z.
RT Two distinct cellular phospholipoproteins bind to the c-fos serum response element
RL EMBO J. 8:1785-1792 (1989).
RN [3]; RE0001202.
RX PUBMED: 3380098.
RA Walsh K., Schimmel P.
RT DNA-binding site for two skeletal actin promoter factors is important for expression in muscle cells
RL Mol. Cell. Biol. 8:1800-1802 (1988).
RN [4]; RE0001203.
RX PUBMED: 2501661.
RA Walsh K.
RT Cross-Binding of Factors to Functionally Different Promoter Elements in c-fos and Skeletal Actin Genes
RL Mol. Cell. Biol. 9:2191-2201 (1989).
RN [5]; RE0001687.
RX PUBMED: 1508214.
RA Gualberto A., LePage D., Pons G., Mader S. L., Park K., Atchison M. L., Walsh K.
RT Functional antagonism between YY1 and the serum response factor
RL Mol. Cell. Biol. 12:4209-4214 (1992).
RN [6]; RE0001883.
RX PUBMED: 1720509.
RA Seto E., Shi Y., Shenk T.
RT YY1 is an initiator sequence-binding protein that directs and activates transcription in vitro
RL Nature 354:241-245 (1991).
RN [7]; RE0003777.
RX PUBMED: 8221895.
RA Schwabe J. W. R., Chapman L., Finch J. T., Rhodes D.
RT The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements
RL Cell 75:567-578 (1993).
RN [8]; RE0004998.
RX PUBMED: 7479833.
RA Guo B., Odgren P. R., Wijnen A. J., Last T. J., Nickerson J., Penman S., Lian J. B., Stein J. L., Stein G. S.
RT The nuclear matrix protein NMP-1 is the transcription factor YY1
RL Proc. Natl. Acad. Sci. USA 92:10526-10530 (1995).
RN [9]; RE0006424.
RX PUBMED: 8917507.
RA Yang W. M., Inouye C., Zeng Y. Y., Bearss D., Seto E.
RT Transcriptional repression by YY1 is mediated by interaction with a mammalian homolog of yeast global regulator RPD3
RL Proc. Natl. Acad. Sci. USA 93:12845-12850 (1996).
RN [10]; RE0006591.
RX PUBMED: 8327494.
RA Lee J.-S., Galvin K. M., Shi Y.
RT Evidence for physical interaction between the zinc-finger transcription factors YY1 and Sp1
RL Proc. Natl. Acad. Sci. USA 90:6145-6149 (1993).
RN [11]; RE0006733.
RX PUBMED: 7731802.
RA Gaston K., Fried M.
RT CpG methylation has differential effects on the binding of YY1 and ETS proteins to the bi-directional promoter of the Surf-1 and Surf-2 genes
RL Nucleic Acids Res. 23:901-909 (1995).
RN [12]; RE0006734.
RX PUBMED: 7758944.
RA Lee J.-S., Galvin K. M., See R. H., Eckner R., Livingstone D., Moran E., Shi Y.
RT Relief of YY1 transcriptional repression by adenovirus E1A is mediated by E1A-associated protein p300
RL Genes Dev. 9:1188-1198 (1995).
RN [13]; RE0006768.
RX PUBMED: 7565750.
RA Natesan S., Gilman M.
RT YY1 facilitates the association of serum response factor with the c-fos serum response element
RL Mol. Cell. Biol. 15:5975-5982 (1995).
RN [14]; RE0013709.
RX PUBMED: 1570345.
RA Dworetzky S. I., Wright K. L., Fey E. G., Penman S., Lian J. B., Stein J. L., Stein G. S.
RT Sequence-specific DNA-binding proteins are components of a nuclear matrix-attachment site
RL Proc. Natl. Acad. Sci. USA 89:4178-4182 (1992).
RN [15]; RE0014659.
RX PUBMED: 8855231.
RA Shrivastava A., Yu J., Artandi S., Calame K.
RT YY1 and c-Myc associate in vivo in a manner that depends on c-Myc levels
RL Proc. Natl. Acad. Sci. USA 93:10638-10641 (1996).
RN [16]; RE0015255.
RX PUBMED: 8753872.
RA Seo H., Yang C., Kim H. S., Kim K. S.
RT Multiple protein factors interact with the cis-regulatory elements of the proximal promoter in a cell-specific manner and regulate transcription of the dopamine beta-hydroxylase gene
RL J. Neurosci. 16:4102-4112 (1996).
RN [17]; RE0015512.
RX PUBMED: 9346952.
RA Yang W. M., Yao Y. L., Sun J. M., Davie J. R., Seto E.
RT Isolation and characterization of cDNAs corresponding to an additional member of the human histone deacetylase gene family
RL J. Biol. Chem. 272:28001-28007 (1997).
RN [18]; RE0025100.
RX PUBMED: 9171244.
RA Chen C. Y., Schwartz R. J.
RT Competition between negative acting YY1 versus positive acting serum response factor and tinman homologue Nkx-2.5 regulates cardiac alpha-actin promoter activity.
RL Mol. Endocrinol. 11:812-822 (1997).
RN [19]; RE0025357.
RX PUBMED: 15295102.
RA Gronroos E., Terentiev A. A., Punga T., Ericsson J.
RT YY1 inhibits the activation of the p53 tumor suppressor in response to genotoxic stress.
RL Proc. Natl. Acad. Sci. USA 101:12165-12170 (2004).
RN [20]; RE0028372.
RX PUBMED: 11486036.
RA Yao Y. L., Yang W. M., Seto E.
RT Regulation of transcription factor YY1 by acetylation and deacetylation.
RL Mol. Cell. Biol. 21:5979-91 (2001).
RN [21]; RE0053243.
RX PUBMED: 12920132.
RA Yao Y. L., Yang W. M.
RT The metastasis-associated proteins 1 and 2 form distinct protein complexes with histone deacetylase activity.
RL J. Biol. Chem. 278:42560-42568 (2003).
RN [22]; RE0063797.
RX PUBMED: 15966902.
RA Delehouzee S., Yoshikawa T., Sawa C., Sawada J., Ito T., Omori M., Wada T., Yamaguchi Y., Kabe Y., Handa H.
RT GABP, HCF-1 and YY1 are involved in Rb gene expression during myogenesis.
RL Genes Cells 10:717-731 (2005).
RN [23]; RE0047713.
RX PUBMED: 10224053.
RA Bennett M. K., Ngo T. T., Athanikar J. N., Rosenfeld J. M., Osborne T. F.
RT Co-stimulation of promoter for low density lipoprotein receptor gene by sterol regulatory element-binding protein and Sp1 is specifically disrupted by the yin yang 1 protein.
RL J. Biol. Chem. 274:13025-13032 (1999).
XX
//