AC T00140
XX
ID T00140
XX
DT 15.10.1992 (created); ewi.
DT 29.02.2016 (updated); smt.
CO Copyright (C), QIAGEN.
XX
FA c-Myc-isoform1
XX
SY c-Myc; c-Myc 2; MYC; v-myc myelocytomatosis viral oncogene homolog (avian).
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G000221 MYC; HGNC: MYC.
XX
CL C0012; bHLH-ZIP; 1.2.6.5.1.1.
XX
SZ 439 AA; 48.8 kDa (cDNA) (calc.), 61, 64, 67 kDa (SDS)
XX
SQ MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
SQ LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
SQ DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
SQ LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
SQ HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
SQ HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
SQ VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
SQ RKRREQLKHKLEQLRNSCA
XX
SC Swiss-Prot#P01106-1
XX
FT 1 345 
PF01056; Myc amino-terminal region.
FT 347 382 
interaction with p73alpha [54].
FT 354 407 
PS50888; HLH.
FT 355 407 
PF00010; Helix-loop-helix DNA-binding domain.
FT 360 412 
SM00353; finulus.
FT 367 407 
helix-loop-helix domain (dimerization and specific DNA-binding) [12].
FT 408 439 
PF02344; Myc leucine zipper domain.
XX
SF The c-Myc-isoform1 T00140 is truncated (c-Myc 340 - 349) [65];
SF isolated bHLH-ZIP region: mycPp;
SF bHLH-ZIP domain interacts with the C-terminal part of AP-2 [27];
SF pRb related protein p107 forms a specific complex with the N-terminal transactivation domain of c-Myc-isoform1 in vivo, binding causes a significant inhibition of c-Myc-isoform1 transactivation [24];
SF Oncogene c-myc is composed of three exons and is transcribed from two initiation sites separated by 175 base-pair DNA in HeLa-cells;
SF exon 1 lacks a methionine codon and is therefore non-coding [40];
SF the initiator methionine is located 16 bp downstream from the 5' splice acceptor of exon 2 [38];
SF a stem-loop secondary structure for the human c-myc RNA may be proposed, because a region of exon 1 (nucleotides 283-350) have a high complementary to a region of exon 2 (nucleotides 2456-2526), lack of exon 1 means that such a stem-loop structure cannot be formed for this RNA [38];
SF the loss of exon 1 may be a common feature of human Burkitt lymphoma and murine plasmocytoma in which c-myc is rearranged [44];
SF C-terminal domain of c-Myc-isoform1 can interact with Max, Nmi, YY-1, p73alpha [42] [43] [54];
SF belongs to group B HLH-proteins that bind to CACGTG motif in DNA due to certain residues in DNA-binding domain (His at pos. 359, Glu at pos. 363, Arg at pos. 367) and thus homology to MAX T05056, T00489>, T01567 in this region [51] [52];
XX
FF c-Myc-isoform1 causes release of cytochrome C from mitochondria and subsequent Caspase-9 processing [53];
FF proto-oncogene involved in cell proliferation control, may induce apoptosis;
FF may be involved in post-transcriptional regulation of rRNA metabolism [20];
FF Myc induces cyclin A and cyclin E expression and leads to a growth factor-independent association of cyclin A with E2F, very early in the cell cycle, Myc acts to suppress expression of cyclin D1 [25];
FF ability of Myc to activate telomerase may contribute to its ability to promote tumor formation [37];
FF Ser-62 phosphorylation enhances trans-activating potential;
FF negative autoregulation;
FF negatively regulated by AP-2 [27];
FF involvement of the androgen receptor in c-myc down-regulation [32];
FF overexpression of Myc causes down-regulation of the thrombospondin-1 gene, an important negative modulator of tumor angiogenesis [36];
FF Myc is destroyed by ubiquitin-mediated proteolysis in vivo, two elements in Myc oppositely regulate its stability: a transcriptional activation domain that promotes Myc destruction and a region required for association with the POZ domain protein Miz-1 that stabilizes Myc [39];
XX
IN T00035 AP-2alphaA; human, Homo sapiens.
IN T09303 BAF47-isoformA; human, Homo sapiens.
IN T03490 Bin1-isoform1; human, Homo sapiens.
IN T04074 brca1; human, Homo sapiens.
IN T00140 c-Myc-isoform1; human, Homo sapiens.
IN T02727 cyclinT1; human, Homo sapiens.
IN T00992 Hsp90; human, Homo sapiens.
IN T01567 Max-isoform1; human, Homo sapiens.
IN T00489 Max-isoform2; human, Homo sapiens.
IN T01566 Max-isoform3; human, Homo sapiens.
IN T00523 Max; mouse, Mus musculus.
IN T05056 Max; human, Homo sapiens.
IN T09085 Max; Mammalia.
IN T00490 MAZ-isoform1; human, Homo sapiens.
IN T03414 Miz-1; human, Homo sapiens.
IN T03483 Nmi; human, Homo sapiens.
IN T01486 p107; human, Homo sapiens.
IN T34249 p21Cip1; human, Homo sapiens.
IN T01427 p300; human, Homo sapiens.
IN T23091 p300; Mammalia.
IN T04931 p73alpha; human, Homo sapiens.
IN T00722 pRb; human, Homo sapiens.
IN T01003 SSRP1; human, Homo sapiens.
IN T27164 Tip60; human, Homo sapiens.
IN T05140 trrap; human, Homo sapiens.
IN T00915 YY1; human, Homo sapiens.
XX
MX M01145 V$CMYC_01.
MX M01154 V$CMYC_02.
MX M07601 V$CMYC_Q3.
MX M03867 V$CMYC_Q6_01.
MX M01034 V$EBOX_Q6_01.
MX M00118 V$MYCMAX_01.
MX M00123 V$MYCMAX_02.
MX M00615 V$MYCMAX_03.
MX M00322 V$MYCMAX_B.
MX M00799 V$MYC_Q2.
XX
BS R12283.
BS R12284.
BS R12285.
BS R12286.
BS R12287.
BS R12288.
BS R12289.
BS R12290.
BS R12291.
BS R12292.
BS R12293.
BS R12294.
BS R12295.
BS R12296.
BS R12297.
BS R12298.
BS R12299.
BS R12300.
BS R12301.
BS R02092.
BS R02094.
BS R03222.
BS R03223.
BS R03224.
BS R03225.
BS R03226.
BS R03227.
BS R03228.
BS R03229.
BS R03230.
BS R04455.
BS R12424.
BS R12425.
BS R12426.
BS R08895.
BS R08897.
BS R08899.
BS R09477.
BS R09594.
BS R09595.
BS R19929.
BS R32214.
BS R32218.
BS R32215.
BS R32216.
BS R09493.
BS R01916.
BS R02893.
BS R04415.
BS R04462.
BS R09480.
BS R09484.
BS R18807.
BS R18808.
BS R18884.
BS R15674.
BS R08889.
BS R08891.
BS R08892.
BS R08893.
BS R19591.
BS R08887.
BS R08888.
BS R02207.
BS R09539.
BS R04414.
BS R14386.
XX
DR TRANSPATH: MO000019613.
DR EMBL: K02276; HSMYCDT.
DR EMBL: V00568; HSMYC1.
DR EMBL: X00196; HSMYCE12.
DR EMBL: X00364; HSMYCC.
DR UniProtKB: P01106-1;
XX
RN [1]; RE0000173.
RX PUBMED: 1840505.
RA Prendergast G. C., Lawe D., Ziff E. B.
RT Association of Myn, the murine homolog of Max, with c-Myc stimulates methylation-sensitive DNA binding and ras cotransformation
RL Cell 65:395-407 (1991).
RN [2]; RE0000428.
RX PUBMED: 2686984.
RA Ariga H., Imamura Y., Iguchi-Ariga S. M. M.
RT DNA replication origin and transcriptional enhancer in c-myc gene share the c-myc protein binding sequences
RL EMBO J. 8:4273-4279 (1989).
RN [3]; RE0000763.
RX PUBMED: 2269425.
RA Luescher B., Eisenman R. N.
RT New light on Myc and Myb. Part I. Myc
RL Genes Dev. 4:2025-2035 (1990).
RN [4]; RE0000928.
RX PUBMED: 1748630.
RA Seth A., Alvarez E., Gupta S., Davis R. J.
RT A phosphorylation site located in the NH2-terminal domain of c-Myc increases transactivation of gene expression
RL J. Biol. Chem. 266:23521-23524 (1991).
RN [5]; RE0001483.
RX PUBMED: 1990293.
RA Dang C. V., Barrett J., Villa-Garcia M., Resar L. M. S., Kato G. J., Fearon E. R.
RT Intracellular leucine zipper interactions suggest c-Myc hetero-oligomerization
RL Mol. Cell. Biol. 11:954-962 (1991).
RN [6]; RE0001508.
RX PUBMED: 2204813.
RA Smith M. J., Charron-Prochownik D. C., Prochownik E. V.
RT The leucine zipper of c-Myc is required for full inhibition of erythroleukemia differentiation
RL Mol. Cell. Biol. 10:5333-5339 (1990).
RN [7]; RE0001510.
RX PUBMED: 2233723.
RA Kato G. J., Barrett J., Villa-Garcia M., Dang C. V.
RT An amino-terminal c-Myc domain required for neoplastic transformation activates transcription
RL Mol. Cell. Biol. 10:5914-5920 (1990).
RN [8]; RE0001864.
RX PUBMED: 2645525.
RA Dang C. V., McGuire M., Buckmire M., Lee W. M. F.
RT Involvement of the 'leucine zipper' region in the oligomerization and transforming activity of human c-myc protein
RL Nature 337:664-666 (1989).
RN [9]; RE0001865.
RX PUBMED: 1865909.
RA Rustgi A. K., Dyson N., Bernards R.
RT Amino-terminal domains of c-myc and N-myc proteins mediate binding to the retinoblastoma gene product
RL Nature 352:541-544 (1991).
RN [10]; RE0002438.
RX PUBMED: 1502157.
RA Bossone St. A., Asselin C., Patel A. J., Marcu K. B.
RT MAZ, a zinc finger protein, binds to c-MYC and C2 gene sequences regulating transcriptional initiation and termination
RL Proc. Natl. Acad. Sci. USA 89:7452-7456 (1992).
RN [11]; RE0002511.
RX PUBMED: 2068097.
RA Halazonetis T. D., Kandil A. N.
RT Determination of the C-MYC DNA-binding site
RL Proc. Natl. Acad. Sci. USA 88:6162-6166 (1991).
RN [12]; RE0002652.
RX PUBMED: 2251503.
RA Blackwell T. K., Kretzner L., Blackwood E. M., Eisenman R. N., Weintraub H.
RT Sequence-specific DNA binding by the c-Myc protein
RL Science 250:1149-1151 (1990).
RN [13]; RE0002653.
RX PUBMED: 2006410.
RA Blackwood E. M., Eisenman R. N.
RT Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc
RL Science 251:1211-1217 (1991).
RN [14]; RE0002664.
RX PUBMED: 1987636.
RA Prendergast G. C., Ziff E. B.
RT Methylation-sensitive sequence-specific DNA binding by the c-Myc basic region
RL Science 251:186-189 (1991).
RN [15]; RE0003327.
RX PUBMED: 2201910.
RA Penn L. J. Z., Brooks M. W., Laufer E. M., Littlewood T. D., Morgenstern J. P., Evan G. I., Lee W. M. F., Land H.
RT Domains of human c-myc protein required for autosuppression and cooperation with ras oncogenes are overlapping
RL Mol. Cell. Biol. 10:4961-4966 (1990).
RN [16]; RE0003329.
RX PUBMED: 3118189.
RA Broome H. E., Reed J. C., Godillot E. P., Hoover R. G.
RT Differential promoter utilization by the c-myc gene in mitogen- and interleukin-2-stimulated human lymphocytes
RL Mol. Cell. Biol. 7:2988-2993 (1987).
RN [17]; RE0003333.
RX PUBMED: 3299053.
RA Stone J., de Lange T., Ramsey G., Jakobovits E., Bishop J. M., Varmus H. E., Lee W. M. F.
RT Definition of regions in human c-myc that are involved in transformation and nuclear translocation
RL Mol. Cell. Biol. 7:1697-1709 (1987).
RN [18]; RE0003340.
RX PUBMED: 1630819.
RA Dubik D., Shiu R. P. C.
RT Mechanism of estrogen activation of c-myc oncogene expression
RL Oncogene 7:1587-1594 (1992).
RN [19]; RE0003341.
RX PUBMED: 6414718.
RA Battey J., Moulding C., Taub R.
RT The human c-myc oncogene: structural consequences of translocation into the IgH locus in Burkitt lymphoma
RL Cell 34:779-787 (1983).
RN [20]; RE0003345.
RX PUBMED: 1437160.
RA Gibson A. W., Ye R., Johnston R. N., Browder L. W.
RT A possible role for c-Myc oncoproteins in post-transcriptional regulation of ribosomal RNA
RL Oncogene 7:2363-2367 (1992).
RN [21]; RE0003352.
RX PUBMED: 8356088.
RA Bello-Fernandez C., Packham G., Cleveland J. L.
RT The ornithine decarboxylase gene is a transcriptional target of c-Myc
RL Proc. Natl. Acad. Sci. USA 90:7804-7808 (1993).
RN [22]; RE0003354.
RX PUBMED: 8247524.
RA Henriksson M., Bakardjiev A., Klein G., Luescher B.
RT Phosphorylation sites mapping in the N-terminal domain of c-myc modulate its transforming potential
RL Oncogene 8:3199-3209 (1993).
RN [23]; RE0003355.
RX PUBMED: 2663470.
RA Luescher B., Kuenzel E. A., Krebs E. G., Eisenman R. N.
RT Myc oncoproteins are phosphorylated by casein kinase II
RL EMBO J. 8:1111-1119 (1989).
RN [24]; RE0003366.
RX PUBMED: 8076603.
RA Beijersbergen R. L., Hijmans E. M., Zhu L., Bernards R.
RT Interaction of c-Myc with the Rb-related protein p107 results in inhibition of c-Myc-mediated transactivation
RL EMBO J. 13:4080-4086 (1994).
RN [25]; RE0004125.
RX PUBMED: 8386381.
RA Jansen-Duerr P., Meichle A., Steiner P., Pagano M., Finke K., Botz J., Wessbecher J., Draetta G., Eilers M.
RT Differential modulation of cyclin gene expression by MYC
RL Proc. Natl. Acad. Sci. USA 90:3685-3689 (1993).
RN [26]; RE0004728.
RX PUBMED: 1651323.
RA Alvarez E., Northwood I. C., Gonzalez F. A., Latour D. A., Seth A., Abate C., Curran T., Davis R. J.
RT Pro-Leu-Ser/Thr-Pro is a consensus primary sequence for substrate protein phosphorylation. Characterization of the phosphorylation of c-myc and c-jun proteins by an epidermal growth factor receptor threonine 669 protein kinase
RL J. Biol. Chem. 266:15277-15285 (1991).
RN [27]; RE0005819.
RX PUBMED: 7729426.
RA Gaubatz S., Imhof A., Dosch R., Werner O., Mitchell P., Buettner R., Eilers M.
RT Transcriptional avtivation by Myc is under negative control by the transcription factor AP-2
RL EMBO J. 14:1508-1519 (1995).
RN [28]; RE0005962.
RX PUBMED: 9311992.
RA Alevizopoulos K., Vlach J., Hennecke S., Amati B.
RT Cyclin E and c-Myc promote cell proliferation in the presence of p16INK4a and of hypophosphorylated retinoblastoma family proteins
RL EMBO J. 16:5322-5333 (1997).
RN [29]; RE0007029.
RX PUBMED: 9175477.
RA Grandori C.
RT Myc target genes
RL Trends Biochem. Sci. 22:177-181 (1997).
RN [30]; RE0011847.
RX PUBMED: 8524267.
RA Mol P. C., Wang R.-H., Batey D. W., Lee L. A., Dang C. V., Berger S. L.
RT Do products of the myc proto-oncogene play a role in transcriptional regulation of the prothymosin alpha gene?
RL Mol. Cell. Biol. 15:6999-7009 (1995).
RN [31]; RE0013466.
RX PUBMED: 9312026.
RA Peukert K., Staller P., Schneider A., Carmichael G., Hanel F., Eilers M.
RT An alternative pathway for gene regulation by Myc
RL EMBO J. 16:5672-5686 (1997).
RN [32]; RE0014488.
RX PUBMED: 1373070.
RA Wolf D. A., Kohlhuber F., Schulz P., Fittler F., Eick D.
RT Transcriptional down-regulation of c-myc in human prostate carcinoma cells by the synthetic androgen mibolerone
RL Br. J. Cancer 65:376-82 (1992).
RN [33]; RE0014489.
RX PUBMED: 1734524.
RA Halazonetis T. D., Kandil A. N.
RT Predicted structural similarities of the DNA binding domains of c-Myc and endonuclease Eco RI
RL Science 255:464-466 (1992).
RN [34]; RE0014490.
RX PUBMED: 1378845.
RA Celano P., Berchtold C. M., Kizer D. L., Weeraratna A., Nelkin B. D., Baylin S. B., Casero R. A. Jr.
RT Characterization of an endogenous RNA transcript with homology to the antisense strand of the human c-myc gene
RL J. Biol. Chem. 267:15092-15096 (1992).
RN [35]; RE0014511.
RX PUBMED: 6419122.
RA Rabbitts T. H., Hamlyn P. H., Baer R.
RT Altered nucleotide sequences of a translocated c-myc gene in Burkitt lymphoma
RL Nature 306:760-765 (1983).
RN [36]; RE0014550.
RX PUBMED: 10871348.
RA Janz A., Sevignani C., Kenyon K., Ngo C. V., Thomas-Tikhonenko A.
RT Activation of the Myc oncoprotein leads to increased turnover of thrombospondin-1 mRNA
RL Nucleic Acids Res. 28:2268-2275 (2000).
RN [37]; RE0014554.
RX PUBMED: 9637678.
RA Wang J., Xie L. Y., Allan S., Beach D., Hannon G. J.
RT Myc activates telomerase
RL Genes Dev. 12:1769-1774 (1998).
RN [38]; RE0014561.
RX PUBMED: 6324175.
RA Saito H., Hayday A. C., Wiman K., Hayward W.S., Tonegawa S.
RT Activation of the c-myc gene by translocation: a model for translational control
RL Proc. Natl. Acad. Sci. USA 80:7476-7480 (1983).
RN [39]; RE0014563.
RX PUBMED: 9927431.
RA Salghetti S. E., Kim S. Y., Tansey W. P.
RT Destruction of Myc by ubiquitin-mediated proteolysis: cancer-associated and transforming mutations stabilize Myc
RL EMBO J. 18:717-726 (1999).
RN [40]; RE0014651.
RX PUBMED: 9806555.
RA Li Y., Behringer R. R.
RT Esx1 is an X-chromosome-imprinted regulator of placental development and fetal growth
RL Nat. Genet. 20:309-311 (1998).
RN [41]; RE0014656.
RX PUBMED: 9792694.
RA Mori K., Maeda Y., Kitaura H., Taira T., Iguchi-Ariga S. M., Ariga H.
RT MM-1, a novel c-Myc-associating protein that represses transcriptional activity of c-Myc
RL J. Biol. Chem. 273:29794-29800 (1998).
RN [42]; RE0014659.
RX PUBMED: 8855231.
RA Shrivastava A., Yu J., Artandi S., Calame K.
RT YY1 and c-Myc associate in vivo in a manner that depends on c-Myc levels
RL Proc. Natl. Acad. Sci. USA 93:10638-10641 (1996).
RN [43]; RE0014660.
RX PUBMED: 7690963.
RA Hateboer G., Timmers H. T. M., Rustgi A. K., Billaud M., van't Veer L. J., Bernards R.
RT TATA-binding protein and the retinoblastoma gene product bind to overlapping epitopes on c-Myc and adenovirus E1A protein
RL Proc. Natl. Acad. Sci. USA 90:8489-8493 (1993).
RN [44]; RE0014662.
RX PUBMED: 8134115.
RA Negishi Y., Nishita Y., Saegusa Y., Kakizaki I., Galli I., Kihara F., Tamai K., Miyajima N., Iguchi-Ariga S. M., Ariga H.
RT Identification and cDNA cloning of single-stranded DNA binding proteins that interact with the region upstream of the human c-myc gene
RL Oncogene 9:1133-1143 (1994).
RN [45]; RE0014667.
RX PUBMED: 8668343.
RA Bao J., Zervos A. S.
RT Isolation and characterization of Nmi, a novel partner of Myc proteins
RL Oncogene 16:2171-2176 (1996).
RN [46]; RE0014674.
RX PUBMED: 8782822.
RA Sakamuro D., Elliott K. J., Wechsler-Reya R., Prendergast G. C.
RT BIN1 is a novel MYC-interacting protein with features of a tumour suppressor
RL Nat. Genet. 14:69-77 (1996).
RN [47]; RE0014676.
RX PUBMED: 10205150.
RA Macdonald K., Bennett M. R.
RT cdc25A is necessary but not sufficient for optimal c-myc-induced apoptosis and cell proliferation of vascular smooth muscle cells
RL Circ. Res. 84:820-830 (1999).
RN [48]; RE0014688.
RX PUBMED: 10637317.
RA Kyo S., Takakura M., Taira T., Kanaya T., Itoh H., Yutsudo M., Ariga H., Inoue M.
RT Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT)
RL Nucleic Acids Res. 28:669-677 (2000).
RN [49]; RE0015744.
RX PUBMED: 10737792.
RA Coller H. A., Grandori C., Tamayo P., Colbert T., Lander E. S., Eisenman R. N., Golub T. R.
RT Expression analysis with oligonucleotide microarrays reveals that MYC regulates genes involved in growth, cell cycle, signaling, and adhesion
RL Proc. Natl. Acad. Sci. USA 97:3260-3265 (2000).
RN [50]; RE0015747.
RX PUBMED: 8712067.
RA Henriksson M., Luescher B.
RT Proteins of the Myc network: essential regulators of cell growth and differentiation
RL Adv. Cancer Res. 68:109-182 (1996).
RN [51]; RE0017805.
RX PUBMED: 9860302.
RA Meng X., Lu X., Li Z., Green E. D., Massa H., Trask B. J., Morris C. A., Keating M. T.
RT Complete physical map of the common deletion region in Williams syndrome and identification and characterization of three novel genes
RL Hum. Genet. 103:590-599 (1998).
RN [52]; RE0017817.
RX PUBMED: 11073985.
RA Billin A. N., Eilers A. L., Coulter K. L., Logan J. S., Ayer D. E.
RT MondoA, a novel basic helix-loop-helix-leucine zipper transcriptional activator that constitutes a positive branch of a max-like network
RL Mol. Cell. Biol. 20:8845-8854 (2000).
RN [53]; RE0021264.
RX PUBMED: 10822387.
RA Hotti A., Jaervinen K., Siivola P., Hoelttae E.
RT Caspases and mitochondria in c-Myc-induced apoptosis: identification of ATM as a new target of caspases
RL Oncogene 19:2354-2362 (2000).
RN [54]; RE0024863.
RX PUBMED: 12080043.
RA Uramoto H., Izumi H., Ise T., Tada M., Uchiumi T., Kuwano M., Yasumoto K., Funa K., Kohno K.
RT p73 Interacts with c-Myc to regulate Y-box-binding protein-1 expression.
RL J. Biol. Chem. 277:31694-31702 (2002).
RN [55]; RE0035556.
RX PUBMED: 16126174.
RA Zhang K., Faiola F., Martinez E.
RT Six lysine residues on c-Myc are direct substrates for acetylation by p300.
RL Biochem. Biophys. Res. Commun. 336:274-280 (2005).
RN [56]; RE0046069.
RX PUBMED: 10319872.
RA Cheng S. W., Davies K. P., Yung E., Beltran R. J., Yu J., Kalpana G. V.
RT c-MYC interacts with INI1/hSNF5 and requires the SWI/SNF complex for transactivation function
RL Nat. Genet. 22:102-5 (1999).
RN [57]; RE0046489.
RX PUBMED: 10551811.
RA Noguchi K., Kitanaka C., Yamana H., Kokubu A., Mochizuki T., Kuchino Y.
RT Regulation of c-Myc through phosphorylation at Ser-62 and Ser-71 by c-Jun N-terminal kinase
RL J. Biol. Chem. 274:32580-7 (1999).
RN [58]; RE0047829.
RX PUBMED: 16287840.
RA Faiola F., Liu X., Lo S., Pan S., Zhang K., Lymar E., Farina A., Martinez E.
RT Dual regulation of c-Myc by p300 via acetylation-dependent control of Myc protein turnover and coactivation of Myc-induced transcription.
RL Mol. Cell. Biol. 25:10220-10234 (2005).
RN [59]; RE0048200.
RX PUBMED: 12776177.
RA Frank S. R., Parisi T., Taubert S., Fernandez P., Fuchs M., Chan H. M., Livingston D. M., Amati B.
RT MYC recruits the TIP60 histone acetyltransferase complex to chromatin.
RL EMBO Rep. 4:575-580 (2003).
RN [60]; RE0048236.
RX PUBMED: 10744738.
RA Kitaura H., Shinshi M., Uchikoshi Y., Ono T., Iguchi-Ariga S. M., Ariga H.
RT Reciprocal regulation via protein-protein interaction between c-Myc and p21(cip1/waf1/sdi1) in DNA replication and transcription.
RL J. Biol. Chem. 275:10477-10483 (2000).
RN [61]; RE0048248.
RX PUBMED: 12177005.
RA Eberhardy S. R., Farnham P. J.
RT Myc recruits P-TEFb to mediate the final step in the transcriptional activation of the cad promoter.
RL J. Biol. Chem. 277:40156-40162 (2002).
RN [62]; RE0049272.
RX PUBMED: 16410719.
RA Amente S., Gargano B., Varrone F., Ruggiero L., Dominguez-Sola D., Lania L., Majello B.
RT p14ARF directly interacts with Myc through the Myc BoxII domain.
RL Cancer Biol. Ther. 5:287 (2006).
RN [63]; RE0050488.
RX PUBMED: 15121849.
RA Grinberg A. V., Hu C. D., Kerppola T. K.
RT Visualization of Myc/Max/Mad family dimers and the competition for dimerization in living cells.
RL Mol. Cell. Biol. 24:4294-4308 (2004).
RN [64]; RE0066120.
RX PUBMED: 20018866.
RA Fan Y., Dickman K. G., Zong W. X.
RT Akt and c-Myc Differentially Activate Cellular Metabolic Programs and Prime Cells to Bioenergetic Inhibition.
RL J. Biol. Chem. 285:7324-7333 (2010).
RN [65]; RE0048440.
RX PUBMED: 10891489.
RA Wood L. J., Mukherjee M., Dolde C. E., Xu Y., Maher J. F., Bunton T. E., Williams J. B., Resar L. M.
RT HMG-I/Y, a new c-Myc target gene and potential oncogene.
RL Mol. Cell. Biol. 20:5490-5502 (2000).
XX
//