AC T34249
XX
ID T34249
XX
DT 20.12.2005 (created); ili.
DT 10.08.2013 (updated); prb.
CO Copyright (C), QIAGEN.
XX
FA p21Cip1
XX
SY CAP20; cdk-inhibiting protein 1; cdk-interacting protein 1; CDKN1; CDKN1A; CIP1; cyclin-dependent kinase (cdk)-inhibitor p21; cyclin-dependent kinase inhibitor 1; cyclin-dependent kinase inhibitor 1A (p21, Cip1); MDA-6; melanoma differentiation associated protein 6; P21; p21Cip1; p21WAF-1; p21Waf1; SDI1; WAF1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G001161 CDKN1A; HGNC: CDKN1A.
XX
SZ 164 AA; 18.1 kDa (cDNA) (calc.).
XX
SQ MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
SQ GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
SQ PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
XX
SC translated from EMBL #L25610
XX
FT 17 24 
Cy1 (cyclin binding motif 1) [1].
FT 19 69 
PF02234; CDI.
FT 53 58 
K (Cdk binding) site [1].
FT 152 158 
Cy2 (cyclin binding motif 2) [1].
XX
FF Mutation of the residues T145D and S153D of p21 or phosphorylation of the residue S153 increases the cytoplasmic localization of p21 and consequently induces disruption of the stress fibers. [9];
FF p21 wild-type and p21S153D mutant equally inhibited DNA synthesis [9];
XX
IN T00140 c-Myc-isoform1; human, Homo sapiens.
IN T08875 Cdk2-isoform1; human, Homo sapiens.
XX
DR TRANSPATH: MO000056626.
DR EMBL: L25610;
DR UniProtKB: P38936;
XX
RN [1]; RE0021101.
RX PUBMED: 8756624.
RA Chen J., Saha P., Kornbluth S., Dynlacht B. D., Dutta A.
RT Cyclin-binding motifs are essential for the function of p21CIP1
RL Mol. Cell. Biol. 16:4673-4682 (1996).
RN [2]; RE0021333.
RX PUBMED: 11099484.
RA Genini D., Sheeter D., Rought S., Zaunders J. J., Susin S. A., Kroemer G., Richman D. D., Carson D. A., Corbeil J., Leoni L. M.
RT HIV induces lymphocyte apoptosis by a p53-initiated, mitochondrial-mediated mechanism
RL FASEB J. 15:5-6 (2001).
RN [3]; RE0029905.
RX PUBMED: 12407107.
RA Canela N., Rodriguez-Vilarrupla A., Estanyol J. M., Diaz C., Pujol M. J., Agell N., Bachs O.
RT The SET protein regulates G2/M transition by modulating cyclin B-cyclin-dependent kinase 1 activity.
RL J. Biol. Chem. 278:1158-64 (2003).
RN [4]; RE0030216.
RX PUBMED: 12429655.
RA Peng B., Fleming J. B., Breslin T., Grau A. M., Fojioka S., Abbruzzese J. L., Evans D. B., Ayers D., Wathen K., Wu T., Robertson K. D., Chiao P. J.
RT Suppression of tumorigenesis and induction of p15(ink4b) by Smad4/DPC4 in human pancreatic cancer cells.
RL Clin. Cancer Res. 8:3628-38 (2002).
RN [5]; RE0048079.
RX PUBMED: 12522211.
RA Liu L., Rodriguez-Belmonte E. M., Mazloum N., Xie B., Lee M. Y.
RT Identification of a novel protein, PDIP38, that interacts with the p50 subunit of DNA polymerase delta and proliferating cell nuclear antigen.
RL J. Biol. Chem. 278:10041-10047 (2003).
RN [6]; RE0048193.
RX PUBMED: 10393198.
RA Otterlei M., Warbrick E., Nagelhus T. A., Haug T., Slupphaug G., Akbari M., Aas P. A., Steinsbekk K., Bakke O., Krokan H. E.
RT Post-replicative base excision repair in replication foci.
RL EMBO J. 18:3834-3844 (1999).
RN [7]; RE0048236.
RX PUBMED: 10744738.
RA Kitaura H., Shinshi M., Uchikoshi Y., Ono T., Iguchi-Ariga S. M., Ariga H.
RT Reciprocal regulation via protein-protein interaction between c-Myc and p21(cip1/waf1/sdi1) in DNA replication and transcription.
RL J. Biol. Chem. 275:10477-10483 (2000).
RN [8]; RE0048643.
RX PUBMED: 11389691.
RA Huang DY Chang ZF.
RT Interaction of human thymidine kinase 1 with p21(Waf1).
RL Biochem. J. 356:829 (2001).
RN [9]; RE0048804.
RX PUBMED: 16055744.
RA Rodriguez-Vilarrupla A., Jaumot M., Abella N., Canela N., Brun S., Diaz C., Estanyol J. M., Bachs O., Agell N.
RT Binding of calmodulin to the carboxy-terminal region of p21 induces nuclear accumulation via inhibition of protein kinase C-mediated phosphorylation of Ser153.
RL Mol. Cell. Biol. 25:7364-7374 (2005).
RN [10]; RE0048887.
RX PUBMED: 10064589.
RA Asada M., Yamada T., Ichijo H., Delia D., Miyazono K., Fukumuro K., Mizutani S.
RT Apoptosis inhibitory activity of cytoplasmic p21(Cip1/WAF1) in monocytic differentiation.
RL EMBO J. 18:1223-1234 (1999).
RN [11]; RE0048951.
RX PUBMED: 16343435.
RA Oh Y. T., Chun K. H., Oh J. I., Park J. A., Kim Y. U., Lee S. K.
RT PKCdelta modulates p21WAF1/CIP1 ability to bind to Cdk2 during TNFalpha-induced apoptosis.
RL Biochem. Biophys. Res. Commun. 339:1138-1147 (2006).
RN [12]; RE0049426.
RX PUBMED: 10873631.
RA Wang F., Yoshida I., Takamatsu M., Ishido S., Fujita T., Oka K., Hotta H.
RT Complex formation between hepatitis C virus core protein and p21Waf1/Cip1/Sdi1.
RL Biochem. Biophys. Res. Commun. 273:479-484 (2000).
RN [13]; RE0052681.
RX PUBMED: 9111314.
RA Sandhu C., Garbe J., Bhattacharya N., Daksis J., Pan C. H., Yaswen P., Koh J., Slingerland J. M., Stampfer M. R.
RT Transforming growth factor beta stabilizes p15INK4B protein, increases p15INK4B-cdk4 complexes, and inhibits cyclin D1-cdk4 association in human mammary epithelial cells.
RL Mol. Cell. Biol. 17:2458-2467 (1997).
RN [14]; RE0052723.
RX PUBMED: 17553787.
RA Wall S. J., Zhong Z. D., DeClerck Y. A.
RT The cyclin-dependent kinase inhibitors p15INK4B and p21CIP1 are critical regulators of fibrillar collagen-induced tumor cell cycle arrest.
RL J. Biol. Chem. 282:24471-24476 (2007).
XX
//