TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08875 XX ID T08875 XX DT 27.04.2006 (created); anu. DT 22.07.2011 (updated); pos. CO Copyright (C), QIAGEN. XX FA Cdk2-isoform1 XX SY cyclin-dependent kinase 2; p33(cdk2). XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G009981 CDK2; HGNC: CDK2. XX SZ 298 AA; 33.9 kDa (cDNA) (calc.). XX SQ MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH SQ PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS SQ HRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY SQ STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF SQ PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL XX SC translated from EMBL:BT006821 XX IN T04074 brca1; human, Homo sapiens. IN T02936 FOXO1A; human, Homo sapiens. IN T10353 FOXO1A; human, Homo sapiens. IN T34249 p21Cip1; human, Homo sapiens. XX DR TRANSPATH: MO000080771. DR EMBL: BT006821; DR EMBL: X61622; DR UniProtKB: P24941; XX RN [1]; RE0017514. RX PUBMED: 11584018. RA Santaguida M., Ding Q., Berube G., Truscott M., Whyte P., Nepveu A. RT Phosphorylation of the CCAAT displacement protein (CDP)/Cux transcription factor by cyclin A-Cdk1 modulates its DNA binding activity in G(2). RL J. Biol. Chem. 276:45780-45790 (2001). RN [2]; RE0047651. RX PUBMED: 16174846. RA Frouin I., Toueille M., Ferrari E., Shevelev I., Hubscher U. RT Phosphorylation of human DNA polymerase lambda by the cyclin-dependent kinase Cdk2/cyclin A complex is modulated by its association with proliferating cell nuclear antigen. RL Nucleic Acids Res. 33:5354-5361 (2005). RN [3]; RE0048082. RX PUBMED: 9244350. RA Wang H., Shao N., Ding Q. M., Cui J., Reddy E. S., Rao V. N. RT BRCA1 proteins are transported to the nucleus in the absence of serum and splice variants BRCA1a, BRCA1b are tyrosine phosphoproteins that associate with E2F, cyclins and cyclin dependent kinases. RL Oncogene 15:143-157 (1997). RN [4]; RE0048951. RX PUBMED: 16343435. RA Oh Y. T., Chun K. H., Oh J. I., Park J. A., Kim Y. U., Lee S. K. RT PKCdelta modulates p21WAF1/CIP1 ability to bind to Cdk2 during TNFalpha-induced apoptosis. RL Biochem. Biophys. Res. Commun. 339:1138-1147 (2006). RN [5]; RE0052681. RX PUBMED: 9111314. RA Sandhu C., Garbe J., Bhattacharya N., Daksis J., Pan C. H., Yaswen P., Koh J., Slingerland J. M., Stampfer M. R. RT Transforming growth factor beta stabilizes p15INK4B protein, increases p15INK4B-cdk4 complexes, and inhibits cyclin D1-cdk4 association in human mammary epithelial cells. RL Mol. Cell. Biol. 17:2458-2467 (1997). RN [6]; RE0056060. RX PUBMED: 17038621. RA Huang H., Regan K. M., Lou Z., Chen J., Tindall D. J. RT CDK2-dependent phosphorylation of FOXO1 as an apoptotic response to DNA damage. RL Science 314:294-297 (2006). XX //