AC T02936
XX
ID T02936
XX
DT 03.02.2000 (created); rio.
DT 18.02.2015 (updated); sup.
CO Copyright (C), QIAGEN.
XX
FA FOXO1A
XX
SY ALV; FKH1; FKHR.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004744 FOXO1; HGNC: FOXO1.
XX
CL C0023; fork head.
XX
SZ 655 AA; 69.7 kDa (cDNA) (calc.).
XX
SQ MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
SQ ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
SQ APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
SQ LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
SQ PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SQ SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SQ SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
SQ YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
SQ DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
SQ HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
SQ DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
XX
SC Swiss-Prot#Q12778
XX
FT 26 393 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 91 102 
potential repression domain [7].
FT 121 130 
SH3 binding site [7].
FT 124 269 
PF00250; Fork head domain.
FT 158 248 
SM00339; forkneu4.
FT 160 254 
PS50039; FORK_HEAD_3.
FT 165 174 
helix alpha 1 [9].
FT 181 182 
strand beta s1 [9].
FT 183 193 
helix alpha 2 [9].
FT 196 201 
helix alpha 4 [9].
FT 207 218 helix alpha 3 [9].
FT 223 226 strand beta s2 [9].
FT 236 238 strand beta s3 [9].
FT 462 466 NR-interacting domain [7].
FT 596 655 proline rich and acidic serine/threonine-rich transactivation domain [7].
XX
SF chromosomal translocation t(2;
SF 13)(q35;
SF q14) causing alveolar rhabdomyosarcomas fuses Pax-3(1-391) with FKHR [1] [2];
SF in PAX3-FKHR the forkhead domain of FKHR is destroyed while the homeodomain and paired domain of Pax-3 are retained [4];
SF 86% identical to FKHRL1 [3];
XX
CP (adult:) brain, blood, colon, kidney, ovary, skeletal, muscle [3].
XX
FF FOXO1A acts as both coactivator (of human RAR-alpha and TR-alpha) and corepressor (of ER-alpha of human, PR, and GR) [7];
FF activates basal hPDK4 expression (transcriptional activator), while insulin and PKB inhibit the function by phosphorylation;
FF FOXO1A inhibits the growth of MCF-7 breast cancer cells [7];
FF activator, PAX3-FKHR fusion protein is a more potent transcriptional activator than the normal PAX3 although the binding to the e5 recognition sequence is significantly impaired compared to PAX3 [4] [2];
FF in response to insulin AKT-1 represses transcriptional activity of FOXO1A on G6PC [6];
XX
IN T02318 AML3-G1; mouse, Mus musculus.
IN T00040 AR; human, Homo sapiens.
IN T18378 CBP; human, Homo sapiens.
IN T08875 Cdk2-isoform1; human, Homo sapiens.
IN T01488 Cdk2; human, Homo sapiens.
IN T00261 ER-alpha; human, Homo sapiens.
IN T28541 HOXA10; Mammalia.
IN T17460 IRF-3; Mammalia.
IN T05299 NR1B1; human, Homo sapiens.
IN T01427 p300; human, Homo sapiens.
IN T16056 RBPJK; Mammalia.
IN T08264 T3R-beta; human, Homo sapiens.
XX
MX M07286 V$FOXO1A_Q3.
MX M00473 V$FOXO1_01.
MX M00474 V$FOXO1_02.
MX M01216 V$FOXO1_Q5.
XX
BS R34882.
BS R34885.
BS R12972.
BS R04663.
BS R12332.
BS R17223.
BS R18134.
BS R18135.
BS R34886.
BS R66336.
BS R26328.
BS R38801.
BS R38802.
BS R32135.
BS R32136.
XX
DR TRANSPATH: MO000026899.
DR EMBL: AF032885; AF032885.
DR EMBL: U02310;
DR UniProtKB: Q12778;
XX
RN [1]; RE0004208.
RX PUBMED: 8221646.
RA Shapiro D. N., Sublett J. E., Li B., Downing J. R., Naeve C. W.
RT Fusion of PAX3 to a member of the forkhead family of transcription factors in human alveolar rhabdomyosarcoma
RL Cancer Res. 53:5108-5112 (1993).
RN [2]; RE0004212.
RX PUBMED: 8275086.
RA Galili N., Davis R. J., Fredericks W. J., Mukhopadhyay S., Rauscher III F. J., Emanuel B. S., Rovera G., Barr F. G.
RT Fusion of a fork head domain to PAX-3 in the solid tumor alveolar rhabdomyosarcoma
RL Nat. Genet. 5:230-235 (1993).
RN [3]; RE0013365.
RX PUBMED: 9479491.
RA Anderson M. J., Viars C. S., Czekay S., Cavenee W. K., Arden K. C.
RT Cloning and characterization of three human forkhead genes that comprise an FKHR-like gene subfamily
RL Genomics 47:187-199 (1998).
RN [4]; RE0014045.
RX PUBMED: 7862145.
RA Fredericks W. J., Galili N., Mukhopadhyay S., Rovera G., Bennicelli J., Barr F. G., Rauscher F. J. 3rd.
RT The PAX3-FKHR fusion protein created by the t(2;13) translocation in alveolar rhabdomyosarcomas is a more potent transcriptional activator than PAX3
RL Mol. Cell. Biol. 15:1522-1535 (1995).
RN [5]; RE0018000.
RX PUBMED: 10358014.
RA Tang E. D., Nunez G., Barr F. G., Guan K. L.
RT Negative regulation of the forkhead transcription factor FKHR by Akt.
RL J. Biol. Chem. 274:16741-16746 (1999).
RN [6]; RE0018003.
RX PUBMED: 10960473.
RA Schmoll D., Walker K. S., Alessi D. R., Grempler R., Burchell A., Guo S., Walther R., Unterman T. G.
RT Regulation of glucose-6-phosphatase gene expression by protein kinase Balpha and the forkhead transcription factor FKHR. Evidence for insulin response unit-dependent and -independent effects of insulin on promoter activity.
RL J. Biol. Chem. 275:36324-36333 (2000).
RN [7]; RE0028367.
RX PUBMED: 11353774.
RA Zhao H. H., Herrera R. E., Coronado-Heinsohn E., Yang M. C., Ludes-Meyers J. H., Seybold-Tilson K. J., Nawaz Z., Yee D., Barr F. G., Diab S. G., Brown P. H., Fuqua S. A., Osborne C. K.
RT Forkhead homologue in rhabdomyosarcoma functions as a bifunctional nuclear receptor-interacting protein with both coactivator and corepressor functions.
RL J. Biol. Chem. 276:27907-12 (2001).
RN [8]; RE0035555.
RX PUBMED: 15890677.
RA Perrot V., Rechler M. M.
RT The coactivator p300 directly acetylates the forkhead transcription factor Foxo1 and stimulates Foxo1-induced transcription.
RL Mol. Endocrinol. 19:2283-2298 (2005).
RN [9]; RE0047922.
RX PUBMED: 11352721.
RA Weigelt J., Climent I., Dahlman-Wright K., Wikstrom M.
RT Solution structure of the DNA binding domain of the human forkhead transcription factor AFX (FOXO4).
RL Biochemistry 40:5861-5869 (2001).
RN [10]; RE0053316.
RX PUBMED: 18420577.
RA Housley M. P., Rodgers J. T., Udeshi N. D., Kelly T. J., Shabanowitz J., Hunt D. F., Puigserver P., Hart G. W.
RT O-GlcNAc Regulates FoxO Activation in Response to Glucose.
RL J. Biol. Chem. 283:16283-16292 (2008).
RN [11]; RE0055916.
RX PUBMED: 11311120.
RA Woods Y. L., Rena G., Morrice N., Barthel A., Becker W., Guo S., Unterman T. G., Cohen P.
RT The kinase DYRK1A phosphorylates the transcription factor FKHR at Ser329 in vitro, a novel in vivo phosphorylation site.
RL Biochem. J. 355:597-607 (2001).
RN [12]; RE0055918.
RX PUBMED: 17717603.
RA Kitamura T., Kitamura Y. I., Funahashi Y., Shawber C. J., Castrillon D. H., Kollipara R., DePinho R. A., Kitajewski J., Accili D.
RT A Foxo/Notch pathway controls myogenic differentiation and fiber type specification.
RL J. Clin. Invest. 117:2477-2485 (2007).
RN [13]; RE0056059.
RX PUBMED: 18356527.
RA Yuan Z., Becker E. B., Merlo P., Yamada T., DiBacco S., Konishi Y., Schaefer E. M., Bonni A.
RT Activation of FOXO1 by Cdk1 in cycling cells and postmitotic neurons.
RL Science 319:1665-1668 (2008).
RN [14]; RE0056060.
RX PUBMED: 17038621.
RA Huang H., Regan K. M., Lou Z., Chen J., Tindall D. J.
RT CDK2-dependent phosphorylation of FOXO1 as an apoptotic response to DNA damage.
RL Science 314:294-297 (2006).
RN [15]; RE0060049.
RX PUBMED: 15817464.
RA Kim S. J., Winter K., Nian C., Tsuneoka M., Koda Y., McIntosh C. H.
RT Glucose-dependent insulinotropic polypeptide (GIP) stimulation of pancreatic beta-cell survival is dependent upon phosphatidylinositol 3-kinase (PI3K)/protein kinase B (PKB) signaling, inactivation of the forkhead transcription factor Foxo1, and down-regulation of bax expression.
RL J. Biol. Chem. 280:22297-22307 (2005).
RN [16]; RE0064679.
RX PUBMED: 17908694.
RA Abid M. R., Spokes K. C., Shih S. C., Aird W. C.
RT NADPH oxidase activity selectively modulates vascular endothelial growth factor signaling pathways.
RL J. Biol. Chem. 282:35373-35385 (2007).
RN [17]; RE0066240.
RX PUBMED: 18713968.
RA Fabre S., Carrette F., Chen J., Lang V., Semichon M., Denoyelle C., Lazar V., Cagnard N., Dubart-Kupperschmitt A., Mangeney M., Fruman D. A., Bismuth G.
RT FOXO1 regulates L-Selectin and a network of human T cell homing molecules downstream of phosphatidylinositol 3-kinase.
RL J. Immunol. 181:2980-2989 (2008).
RN [18]; RE0070180.
RX PUBMED: 20543840.
RA Zhao Y., Yang J., Liao W., Liu X., Zhang H., Wang S., Wang D., Feng J., Yu L., Zhu W. G.
RT Cytosolic FoxO1 is essential for the induction of autophagy and tumour suppressor activity.
RL Nat. Cell Biol. 12:665-675 (2010).
RN [19]; RE0070735.
RX PUBMED: 20110348.
RA Singh A., Ye M., Bucur O., Zhu S., Tanya Santos M., Rabinovitz I., Wei W., Gao D., Hahn W. C., Khosravi-Far R.
RT Protein phosphatase 2A reactivates FOXO3a through a dynamic interplay with 14-3-3 and AKT.
RL Mol. Biol. Cell 21:1140-1152 (2010).
RN [20]; RE0072074.
RX PUBMED: 21177856.
RA Lee J. W., Chen H., Pullikotil P., Quon M. J.
RT Protein kinase A-alpha directly phosphorylates FoxO1 in vascular endothelial cells to regulate expression of vascular cellular adhesion molecule-1 mRNA.
RL J. Biol. Chem. 286:6423-6432 (2011).
RN [21]; RE0078368.
RX PUBMED: 12493691.
RA Kim J. J., Taylor H. S., Akbas G. E., Foucher I., Trembleau A., Jaffe R. C., Fazleabas A. T., Unterman T. G.
RT Regulation of insulin-like growth factor binding protein-1 promoter activity by FKHR and HOXA10 in primate endometrial cells.
RL Biol. Reprod. 68:24-30 (2003).
XX
//