AC T01427
XX
ID T01427
XX
DT 10.04.1995 (created); ewi.
DT 27.11.2014 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA p300
XX
SY CBP/p300; E1A associated protein; E1A binding protein p300; E1A-associated protein p300; EP300; p300; p300-HAT; transcriptional co-activator p300.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004631 EP300; HGNC: EP300.
XX
SZ 2414 AA; 264.1 kDa (cDNA) (calc.), 300 kDa (SDS)
XX
SQ MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
SQ INQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINS
SQ MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
SQ GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
SQ PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
SQ NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
SQ VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
SQ GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQM
SQ PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
SQ NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
SQ KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
SQ AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
SQ AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNI
SQ PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
SQ TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
SQ LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
SQ EVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK
SQ TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
SQ PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
SQ YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
SQ CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
SQ HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
SQ VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
SQ YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SQ SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
SQ LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SQ SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
SQ CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
SQ WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SQ SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
SQ CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
SQ QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
SQ PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
SQ EPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISP
SQ LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
SQ PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
SQ MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
SQ PQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSP
SQ QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SQ SPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
SQ DLNSNLSQSTLDIH
XX
SC Swiss-Prot#Q09472
XX
FT 1 596 
binding to c-Jun [15].
FT 1 596 
binding to RelA [13].
FT 129 1540 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 331 417 
PS50134; ZF_TAZ.
FT 332 416 
PF02135; TAZ zinc finger.
FT 332 417 
SM00551; ZnF_TAZ.
FT 347 411 
cysteine-/histidine-rich region (16/65), binding to STAT2 [7].
FT 347 411 
cysteine-/histidine-rich region (16/65), binding to SYT [19].
FT 566 645 
PS50952; KIX.
FT 566 646 
PF02172; KIX domain.
FT 744 1571 binding to JunB [15].
FT 1048 1158 SM00297; bromo_6.
FT 1054 1144 PF00439; Bromodomain.
FT 1067 1139 PS50014; BROMODOMAIN_2.
FT 1145 1205 PF06001; Domain of Unknown Function (DUF902).
FT 1257 2414 binding to TFIIB [14].
FT 1280 1517 PF06010; Domain of Unknown Function (DUF906).
FT 1572 2370 binding to c-Jun and JunB [15].
FT 1572 2370 binding to YY1 T00915 [8].
FT 1638 1806 binding to S/MAR binding factor SAF-A/hnRNP-U [12].
FT 1638 1806 cysteine-/histidine-rich region (23/169), binding to SYT [19].
FT 1664 1705 PF00569; Zinc finger, ZZ type.
FT 1664 1705 SM00291; zz_5.
FT 1664 1707 PS50135; ZF_ZZ_2.
FT 1727 1806 PF02135; TAZ zinc finger.
FT 1728 1809 PS50134; ZF_TAZ.
FT 1729 1807 SM00551; ZnF_TAZ.
FT 1737 1809 necessary for binding to E1A T00209 T00967 [8].
XX
SF rich in proline, glutamine, and serine (>30%) [5];
SF interacting with CREB T00163 phosphorylated by PKA, KD = 0.64 uM [4];
SF different subregions may bind to YY1 T00915 and E1A T00209 T00967 [8];
SF related to CBP T02214 [9];
SF competes with TGIF T04076 for binding to the SMAD-2 T04095 complex [10];
SF both CH1 and CH3 domains are required for interactions with SYT [19];
XX
CP (cell lines:) HeLa.
XX
FF p300 may function as a transcriptional adaptor protein for certain complex transcriptional regulatory elements [5];
FF Co-activates c-ets1T00112 and c-ets2T00113 and co-represses p53T00671 [71];
FF transcriptional cofactor;
FF co-activator with intrinsic acetyltransferase activity;
FF co-activator of CREB [14];
FF co-activator of STAT2 [7];
FF co-activator of bHLH proteins [6];
FF co-activator of c-Jun and JunB [15];
FF co-activator of NF-kappaB p65 [13];
FF co-activator of p73 [23] [24];
FF acetyltransferase activity is not required to be a co-activator of p73alpha [23];
FF binds to the N-terminal region of E1A T00209 T00967 thus inducing entry of quiescent cells into S-phase [2] [5];
FF exhibits intrinsic DNA-binding activity (in contrast to CBP T02214) [2];
FF mediates interaction between YY1T00915 and E1A T00209 T00967 [8];
FF binds to scaffold/matrix attached regions (S/MARs) but not in cells transformed with adenovirus or SV40 [12];
FF no binding of p300-SAF-A to S/MAR elements of expressed gene [12];
FF directly interacts with basal transcription factor TFIIB [14];
FF directly interacts with co-activator SYT T05826 [19];
FF co-activator of HPV18 enhanceosome in vivo [18];
FF further enhances synergy between c-Jun and Sp1 factors in hepatocytes and in keratinocytes [20] [21] [22];
XX
IN T05038 ADA3; human, Homo sapiens.
IN T14315 AML1; Mammalia.
IN T02245 AML1b; human, Homo sapiens.
IN T09248 AML2-isoform1; human, Homo sapiens.
IN T08146 AP-2alpha; human, Homo sapiens.
IN T08796 ASC-2; human, Homo sapiens.
IN T10236 ATF-2; Mammalia.
IN T09905 B-Myb; mouse, Mus musculus.
IN T02984 beta-catenin; mouse, Mus musculus.
IN T00123 c-Fos; human, Homo sapiens.
IN T00133 c-Jun; human, Homo sapiens.
IN T09540 c-Krox; mouse, Mus musculus.
IN T00140 c-Myc-isoform1; human, Homo sapiens.
IN T00459 C/EBPbeta-FL; rat, Rattus norvegicus.
IN T09139 C/EBPdelta; human, Homo sapiens.
IN T10310 COUP-TF2; Mammalia.
IN T00163 CREB-A; human, Homo sapiens.
IN T00967 E1A 12S protein; adenovirus.
IN T00209 E1A 13S protein; adenovirus type 2.
IN T04956 FKLF; human, Homo sapiens.
IN T02936 FOXO1A; human, Homo sapiens.
IN T02938 FOXO3a; human, Homo sapiens.
IN T08629 GATA-4; Mammalia.
IN T10207 GATA-6short; human, Homo sapiens.
IN T08994 HIF-1alpha-isoform1; human, Homo sapiens.
IN T01610 HIF-1alpha; human, Homo sapiens.
IN T09250 ipf1; human, Homo sapiens.
IN T10232 ipf1; rat, Rattus norvegicus.
IN T27548 IRF-3; human, Homo sapiens.
IN T01977 JunB; human, Homo sapiens.
IN T09128 LAP*-NF-M; chick, Gallus gallus.
IN T10173 M-Twist; mouse, Mus musculus.
IN T05127 Mam-1; human, Homo sapiens.
IN T00484 MASH-1; rat, Rattus norvegicus.
IN T01005 MEF-2A-isoform1; human, Homo sapiens.
IN T34774 MEF2D; Mammalia.
IN T00526 MyoD; mouse, Mus musculus.
IN T10027 MyoD; Mammalia.
IN T34269 NBS1; human, Homo sapiens.
IN T09437 NF-kappaB1; mouse, Mus musculus.
IN T17520 NF-kappaB1; Mammalia.
IN T01947 NFATc1; mouse, Mus musculus.
IN T00719 NR1B1-isoform1; human, Homo sapiens.
IN T09645 Nrf2-isoform1; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T09500 p53; Mammalia.
IN T24127 p63gamma; Mammalia.
IN T04931 p73alpha; human, Homo sapiens.
IN T06006 p73alpha; monkey, Cercopithecus aethiops.
IN T06014 p73beta; monkey, Cercopithecus aethiops.
IN T14054 PARP; human, Homo sapiens.
IN T14055 PARP; human, Homo sapiens.
IN T15350 PARP; Mammalia.
IN T09150 pax-6-isoform1; mouse, Mus musculus.
IN T00685 PEA3; human, Homo sapiens.
IN T00630 POU3F2; human, Homo sapiens.
IN T08431 PPARalpha; mouse, Mus musculus.
IN T09956 PPARalpha; Mammalia.
IN T03731 PPARgamma2; human, Homo sapiens.
IN T01330 RAR-gamma1; human, Homo sapiens.
IN T00594 RelA-p65-isoform1; human, Homo sapiens.
IN T00595 RelA-p65; mouse, Mus musculus.
IN T10397 RelA-p65; Mammalia.
IN T09284 RORalpha; mouse, Mus musculus.
IN T30231 SIRT1-isoform1; human, Homo sapiens.
IN T29717 SIRT1; human, Homo sapiens.
IN T04095 Smad2-L; human, Homo sapiens.
IN T04431 Smad3; rat, Rattus norvegicus.
IN T22380 Smad7; Mammalia.
IN T21552 SRC-1; Mammalia.
IN T01494 STAT2; human, Homo sapiens.
IN T01493 STAT3; human, Homo sapiens.
IN T01580 STAT6; human, Homo sapiens.
IN T05826 SYT; human, Homo sapiens.
IN T00794 TBP; human, Homo sapiens.
IN T00818 TFIIB; human, Homo sapiens.
IN T08439 TIF2; mouse, Mus musculus.
IN T00915 YY1; human, Homo sapiens.
IN T05150 ZAC-1b; mouse, Mus musculus.
IN T10142 ZAC; mouse, Mus musculus.
XX
MX M00033 V$P300_01.
MX M07266 V$P300_Q5.
XX
BS R04097.
BS R05596.
BS R05597.
BS R05598.
BS R05599.
BS R05600.
BS R05601.
BS R05602.
BS R05603.
BS R05604.
BS R05605.
BS R05606.
BS R05607.
BS R05608.
BS R05609.
BS R05610.
BS R05611.
BS R04348.
BS R11433.
BS R04098.
BS R04705.
BS R01406.
XX
DR TRANSPATH: MO000019985.
DR SMARTDB: SB000089.
DR PATHODB: MT010909.
DR PATHODB: MT010910.
DR EMBL: U01877;
DR UniProtKB: Q09472;
XX
RN [1]; RE0000795.
RX PUBMED: 1829698.
RA Raychaudhuri P., Bagchi S., Devoto S. H., Kraus V. B., Moran E., Nevins J. R.
RT Domains of the adenovirus E1A protein required for oncogenic activity are also required for dissociation of E2F transcription factor complexes
RL Genes Dev. 5:1200-1211 (1991).
RN [2]; RE0002909.
RX PUBMED: 1534143.
RA Rikitake Y., Moran E.
RT DNA-binding properties of the E1A-associated 300-Kilodalton protein
RL Mol. Cell. Biol. 12:2826-2836 (1992).
RN [3]; RE0005532.
RX PUBMED: 1833633.
RA Yaciuk P., Moran E.
RT Analysis with specific polyclonal antiserum indicates that the E1A-associated 300-kDa product is a stable nuclear phosphoprotein that undergoes cell cycle phase-specific modification
RL Mol. Cell. Biol. 11:5389-5397 (1991).
RN [4]; RE0005631.
RX PUBMED: 7870179.
RA Lundblad J. R., Kwok R. P. S., Laurance M. E., Harter M. L., Goodman R. H.
RT Adenoviral E1A-associated protein p300 as a functional homologue of the transcriptional co-activator CBP
RL Nature 374:85-88 (1995).
RN [5]; RE0005632.
RX PUBMED: 7523245.
RA Eckner R., Ewen M. E., Newsome D., Gerdes M., DeCapiro J. A., Lawrence J. B., Livingston D. M.
RT Molecular cloning and functional analysis of the adenovirus E1A-associated 300-kD protein (p300) reveals a protein with properties of a transcriptional adaptor
RL Genes Dev. 8:869-884 (1994).
RN [6]; RE0005904.
RX PUBMED: 8843199.
RA Eckner R., Yao T.-P., Oldread E., Livingston D. M.
RT Interaction and functional collaboration of p300/CBP and bHLH proteins in muscle and B-cell differentiation
RL Genes Dev. 10:2478-2490 (1997).
RN [7]; RE0006163.
RX PUBMED: 8848048.
RA Bhattacharya S., Eckner R., Grossman S., Oldread E., Arany Z., D Andrea A., Livingston D. M.
RT Cooperation of Stat2 and p300/CBP in signalling induced by interferon-alpha
RL Nature 383:344-347 (1996).
RN [8]; RE0006734.
RX PUBMED: 7758944.
RA Lee J.-S., Galvin K. M., See R. H., Eckner R., Livingstone D., Moran E., Shi Y.
RT Relief of YY1 transcriptional repression by adenovirus E1A is mediated by E1A-associated protein p300
RL Genes Dev. 9:1188-1198 (1995).
RN [9]; RE0006865.
RX PUBMED: 9613201.
RA Giles R. H., Peters D. J. M., Breuning M. H.
RT Conjunction dysfunction: CBP/p300 in human disease
RL Trends Genet. 14:178-183 (1998).
RN [10]; RE0015456.
RX PUBMED: 10199400.
RA Wotton D., Lo R. S., Lee S., Massague J.
RT A Smad transcriptional corepressor
RL Cell 97:29-39 (1999).
RN [11]; RE0016813.
RX PUBMED: 10336495.
RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M.
RT Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein
RL J. Biol. Chem. 274:15901-15907 (1999).
RN [12]; RE0017829.
RX PUBMED: 11909954.
RA Martens J. H. A., Verlaan M., Kalkhoven E., Dorsman J. C., Zantema A.
RT Scaffold/matrix attachment region elements interact with a p300-scaffold attachment factor A complex and are bound by acetylated nucleosomes
RL Mol. Cell. Biol. 22:2598-2606 (2002).
RN [13]; RE0018223.
RX PUBMED: 9096323.
RA Gerritsen M. E., Williams A. J., Neish A. S., Moore S., Shi Y., Collins T.
RT CREB-binding protein/p300 are transcriptional coactivators of p65.
RL Proc. Natl. Acad. Sci. USA 94:2927-2932 (1997).
RN [14]; RE0018231.
RX PUBMED: 8663457.
RA Lee J. S., Zhang X., Shi Y.
RT Differential interactions of the CREB/ATF family of transcription factors with p300 and adenovirus E1A.
RL J. Biol. Chem. 271:17666-17674 (1996).
RN [15]; RE0018232.
RX PUBMED: 8754832.
RA Lee J. S., See R. H., Deng T., Shi Y.
RT Adenovirus E1A downregulates cJun- and JunB-mediated transcription by targeting their coactivator p300.
RL Mol. Cell. Biol. 16:4312-4326 (1996).
RN [16]; RE0018982.
RX PUBMED: 10775268.
RA Hecht A., Vleminckx K., Stemmler M. P., van Roy F., Kemler R.
RT The p300/CBP acetyltransferases function as transcriptional coactivators of beta-catenin in vertebrates
RL EMBO J. 19:1839-1850 (2000).
RN [17]; RE0022425.
RX PUBMED: 11100117.
RA Kung A. L., Wang S., Klco J. M., Kaelin W. G., Livingston D. M.
RT Suppression of tumor growth through disruption of hypoxia-inducible transcription.
RL Nat. Med. 6:1335-1340 (2000).
RN [18]; RE0023641.
RX PUBMED: 12640118.
RA Bouallaga I., Teissier S., Yaniv M., Thierry F.
RT HMG-I(Y) and the CBP/p300 coactivator are essential for human papillomavirus type 18 enhanceosome transcriptional activity.
RL Mol. Cell. Biol. 23:2329-2340 (2003).
RN [19]; RE0023772.
RX PUBMED: 11030627.
RA Eid J. E., Kung A. L., Scully R., Livingston D. M.
RT p300 interacts with the nuclear proto-oncoprotein SYT as part of the active control of cell adhesion.
RL Cell 102:839-848 (2000).
RN [20]; RE0024063.
RX PUBMED: 10506225.
RA Kardassis D., Papakosta P., Pardali K., Moustakas A.
RT c-Jun transactivates the promoter of the human p21(WAF1/Cip1) gene by acting as a superactivator of the ubiquitous transcription factor Sp1.
RL J. Biol. Chem. 274:29572-29581 (1999).
RN [21]; RE0024064.
RX PUBMED: 12200429.
RA Jang S. I., Steinert P. M.
RT Loricrin expression in cultured human keratinocytes is controlled by a complex interplay between transcription factors of the Sp1, CREB, AP1, and AP2 families.
RL J. Biol. Chem. 277:42268-42279 (2002).
RN [22]; RE0024074.
RX PUBMED: 12954631.
RA Wang Y. N., Chang W. C.
RT Induction of disease-associated keratin 16 gene expression by epidermal growth factor is regulated through cooperation of transcription factors Sp1 and c-Jun.
RL J. Biol. Chem. 278:45848-45857 (2003).
RN [23]; RE0024370.
RX PUBMED: 11076933.
RA Zeng X., Lee H., Zhang Q., Lu H.
RT p300 does not require its acetylase activity to stimulate p73 function.
RL J. Biol. Chem. 276:48-52 (2001).
RN [24]; RE0024378.
RX PUBMED: 10207051.
RA Zeng X., Chen L., Jost C. A., Maya R., Keller D., Wang X., Kaelin WG J. r., Oren M., Chen J., Lu H.
RT MDM2 suppresses p73 function without promoting p73 degradation.
RL Mol. Cell. Biol. 19:3257-3266 (1999).
RN [25]; RE0026627.
RX PUBMED: 10933397.
RA Youn H. D., Liu J. O.
RT Cabin1 represses MEF2-dependent Nur77 expression and T cell apoptosis by controlling association of histone deacetylases and acetylases with MEF2.
RL Immunity 13:85-94 (2000).
RN [26]; RE0026680.
RX PUBMED: 10851229.
RA Wada H., Hasegawa K., Morimoto T., Kakita T., Yanazume T., Sasayama S.
RT A p300 protein as a coactivator of GATA-6 in the transcription of the smooth muscle-myosin heavy chain gene.
RL J. Biol. Chem. 275:25330-5 (2000).
RN [27]; RE0037527.
RX PUBMED: 11912212.
RA Misra P., Qi C., Yu S., Shah S. H., Cao W. Q., Rao M. S., Thimmapaya B., Zhu Y., Reddy J. K.
RT Interaction of PIMT with transcriptional coactivators CBP, p300, and PBP differential role in transcriptional regulation
RL J. Biol. Chem. 277:20011-9 (2002).
RN [28]; RE0039427.
RX PUBMED: 9606182.
RA Kitabayashi I., Yokoyama A., Shimizu K., Ohki M.
RT Interaction and functional cooperation of the leukemia-associated factors AML1 and p300 in myeloid cell differentiation
RL EMBO J. 17:2994-3004 (1998).
RN [29]; RE0040875.
RX PUBMED: 9407140.
RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M.
RT p300 functions as a coactivator for the peroxisome proliferator-activated receptor alpha
RL J. Biol. Chem. 272:33435-43 (1997).
RN [30]; RE0041697.
RX PUBMED: 11481322.
RA Dai Y. S., Markham B. E.
RT p300 Functions as a coactivator of transcription factor GATA-4
RL J. Biol. Chem. 276:37178-85 (2001).
RN [31]; RE0041698.
RX PUBMED: 11268218.
RA Hasan S., Hassa P. O., Imhof R., Hottiger M. O.
RT Transcription coactivator p300 binds PCNA and may have a role in DNA repair synthesis
RL Nature 410:387-91 (2001).
RN [32]; RE0042226.
RX PUBMED: 12960163.
RA Hassa P. O., Buerki C., Lombardi C., Imhof R., Hottiger M. O.
RT Transcriptional coactivation of nuclear factor-kappaB-dependent gene expression by p300 is regulated by poly(ADP)-ribose polymerase-1
RL J. Biol. Chem. 278:45145-53 (2003).
RN [33]; RE0042557.
RX PUBMED: 15138260.
RA Jin Y. H., Jeon E. J., Li Q. L., Lee Y. H., Choi J. K., Kim W. J., Lee K. Y., Bae S. C.
RT Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation
RL J. Biol. Chem. 279:29409-17 (2004).
RN [34]; RE0042631.
RX PUBMED: 14585496.
RA Ji A., Dao D., Chen J., MacLellan W. R.
RT EID-2, a novel member of the EID family of p300-binding proteins inhibits transactivation by MyoD
RL Gene 318:35-43 (2003).
RN [35]; RE0042632.
RX PUBMED: 10025406.
RA Hamamori Y., Sartorelli V., Ogryzko V., Puri P. L., Wu H. Y., Wang J. Y., Nakatani Y., Kedes L.
RT Regulation of histone acetyltransferases p300 and PCAF by the bHLH protein twist and adenoviral oncoprotein E1A
RL Cell 96:405-13 (1999).
RN [36]; RE0042733.
RX PUBMED: 12718889.
RA Girdwood D., Bumpass D., Vaughan O. A., Thain A., Anderson L. A., Snowden A. W., Garcia-Wilson E., Perkins N. D., Hay R. T.
RT P300 transcriptional repression is mediated by SUMO modification
RL Mol. Cell 11:1043-54 (2003).
RN [37]; RE0042810.
RX PUBMED: 12408818.
RA Gronroos E., Hellman U., Heldin C. H., Ericsson J.
RT Control of Smad7 stability by competition between acetylation and ubiquitination
RL Mol. Cell 10:483-93 (2002).
RN [38]; RE0047584.
RX PUBMED: 10823961.
RA Ko L., Cardona G. R., Chin W. W.
RT Thyroid hormone receptor-binding protein, an LXXLL motif-containing protein, functions as a general coactivator.
RL Proc. Natl. Acad. Sci. USA 97:6212-6217 (2000).
RN [39]; RE0047639.
RX PUBMED: 12068014.
RA Jin Y., Zeng S. X., Dai M. S., Yang X. J., Lu H.
RT MDM2 inhibits PCAF (p300/CREB-binding protein-associated factor)-mediated p53 acetylation.
RL J. Biol. Chem. 277:30838-30843 (2002).
RN [40]; RE0047829.
RX PUBMED: 16287840.
RA Faiola F., Liu X., Lo S., Pan S., Zhang K., Lymar E., Farina A., Martinez E.
RT Dual regulation of c-Myc by p300 via acetylation-dependent control of Myc protein turnover and coactivation of Myc-induced transcription.
RL Mol. Cell. Biol. 25:10220-10234 (2005).
RN [41]; RE0047943.
RX PUBMED: 9343424.
RA Mink S., Haenig B., Klempnauer K. H.
RT Interaction and functional collaboration of p300 and C/EBPbeta.
RL Mol. Cell. Biol. 17:6609-6617 (1997).
RN [42]; RE0048104.
RX PUBMED: 15632193.
RA Bouras T., Fu M., Sauve A. A., Wang F., Quong A. A., Perkins N. D., Hay R. T., Gu W., Pestell R. G.
RT SIRT1 deacetylation and repression of p300 involves lysine residues 1020/1024 within the cell cycle regulatory domain 1.
RL J. Biol. Chem. 280:10264-10276 (2005).
RN [43]; RE0048173.
RX PUBMED: 9862959.
RA Lau P., Bailey P., Dowhan D. H., Muscat G. E.
RT Exogenous expression of a dominant negative RORalpha1 vector in muscle cells impairs differentiation: RORalpha1 directly interacts with p300 and myoD.
RL Nucleic Acids Res. 27:411-420 (1999).
RN [44]; RE0048617.
RX PUBMED: 16574662.
RA Tanaka T., Nishimura D., Wu R. C., Amano M., Iso T., Kedes L., Nishida H., Kaibuchi K., Hamamori Y.
RT Nuclear Rho kinase, ROCK2, targets p300 acetyltransferase.
RL J. Biol. Chem. 281:15320-15329 (2006).
RN [45]; RE0049018.
RX PUBMED: 16024795.
RA Huang W. C., Chen C. C.
RT Akt phosphorylation of p300 at Ser-1834 is essential for its histone acetyltransferase and transcriptional activity.
RL Mol. Cell. Biol. 25:6592-6602 (2005).
RN [46]; RE0049024.
RX PUBMED: 15767673.
RA Poizat C., Puri P. L., Bai Y., Kedes L.
RT Phosphorylation-dependent degradation of p300 by doxorubicin-activated p38 mitogen-activated protein kinase in cardiac cells.
RL Mol. Cell. Biol. 25:2673-2687 (2005).
RN [47]; RE0049085.
RX PUBMED: 16287857.
RA Chen W. Y., Juan L. J., Chung B. C.
RT SF-1 (nuclear receptor 5A1) activity is activated by cyclic AMP via p300-mediated recruitment to active foci, acetylation, and increased DNA binding.
RL Mol. Cell. Biol. 25:10442-10453 (2005).
RN [48]; RE0049102.
RX PUBMED: 16717280.
RA Kim J. H., Yang C. K., Stallcup M. R.
RT Downstream signaling mechanism of the C-terminal activation domain of transcriptional coactivator CoCoA.
RL Nucleic Acids Res. 34:2736-2750 (2006).
RN [49]; RE0049113.
RX PUBMED: 16397300.
RA Wang J. M., Ko C. Y., Chen L. C., Wang W. L., Chang W. C.
RT Functional role of NF-IL6beta and its sumoylation and acetylation modifications in promoter activation of cyclooxygenase 2 gene.
RL Nucleic Acids Res. 34:217-231 (2006).
RN [50]; RE0049164.
RX PUBMED: 15701643.
RA Cheng J., Perkins N. D., Yeh E. T.
RT Differential regulation of c-Jun-dependent transcription by SUMO-specific proteases.
RL J. Biol. Chem. 280:14492-14498 (2005).
RN [51]; RE0049195.
RX PUBMED: 16809786.
RA Hoffmann A., Barz T., Spengler D.
RT Multitasking C2H2 zinc fingers link Zac DNA binding to coordinated regulation of p300-histone acetyltransferase activity.
RL Mol. Cell. Biol. 26:5544-5557 (2006).
RN [52]; RE0049206.
RX PUBMED: 16478987.
RA Bhakat K. K., Mokkapati S. K., Boldogh I., Hazra T. K., Mitra S.
RT Acetylation of human 8-oxoguanine-DNA glycosylase by p300 and its role in 8-oxoguanine repair in vivo.
RL Mol. Cell. Biol. 26:1654-1665 (2006).
RN [53]; RE0049236.
RX PUBMED: 11073990.
RA MacLellan W. R., Xiao G., Abdellatif M., Schneider M. D.
RT A novel Rb- and p300-binding protein inhibits transactivation by MyoD.
RL Mol. Cell. Biol. 20:8903-8915 (2000).
RN [54]; RE0049242.
RX PUBMED: 16923962.
RA Fu M., Liu M., Sauve A. A., Jiao X., Zhang X., Wu X., Powell M. J., Yang T., Gu W., Avantaggiati M. L., Pattabiraman N., Pestell T. G., Wang F., Quong A. A., Wang C., Pestell R. G.
RT Hormonal control of androgen receptor function through SIRT1.
RL Mol. Cell. Biol. 26:8122-8135 (2006).
RN [55]; RE0049297.
RX PUBMED: 12371907.
RA de Luca A., Severino A., De Paolis P., Cottone G., De Luca L., De Falco M., Porcellini A., Volpe M., Condorelli G.
RT p300/cAMP-response-element-binding-protein (CREB)-binding protein (CBP) modulates co-operation between myocyte enhancer factor 2A (MEF2A) and thyroid hormone receptor-retinoid X receptor.
RL Biochem. J. 369:477-484 (2003).
RN [56]; RE0049592.
RX PUBMED: 17272271.
RA Stauffer D., Chang B., Huang J., Dunn A., Thayer M.
RT P300/CBP interacts with ATR and is required for the DNA replication checkpoint.
RL J. Biol. Chem. 282:9678-9687 (2007).
RN [57]; RE0049630.
RX PUBMED: 16374512.
RA Markham D., Munro S., Soloway J., O'Connor D. P., La Thangue N. B.
RT DNA-damage-responsive acetylation of pRb regulates binding to E2F-1.
RL EMBO Rep. 7:192-198 (2006).
RN [58]; RE0049739.
RX PUBMED: 17217336.
RA Faiola F., Wu Y. T., Pan S., Zhang K., Farina A., Martinez E.
RT Max is acetylated by p300 at several nuclear localization residues.
RL Biochem. J. 403:397-407 (2007).
RN [59]; RE0049828.
RX PUBMED: 16204234.
RA Hassa P. O., Haenni S. S., Buerki C., Meier N. I., Lane W. S., Owen H., Gersbach M., Imhof R., Hottiger M. O.
RT Acetylation of poly(ADP-ribose) polymerase-1 by p300/CREB-binding protein regulates coactivation of NF-kappaB-dependent transcription.
RL J. Biol. Chem. 280:40450-40464 (2005).
RN [60]; RE0049909.
RX PUBMED: 16497729.
RA Kim M. Y., Woo E. M., Chong Y. T., Homenko D. R., Kraus W. L.
RT Acetylation of estrogen receptor alpha by p300 at lysines 266 and 268 enhances the deoxyribonucleic acid binding and transactivation activities of the receptor.
RL Mol. Endocrinol. 20:1479-1493 (2006).
RN [61]; RE0050056.
RX PUBMED: 15965232.
RA MacPartlin M., Zeng S., Lee H., Stauffer D., Jin Y., Thayer M., Lu H.
RT p300 regulates p63 transcriptional activity.
RL J. Biol. Chem. 280:30604-30610 (2005).
RN [62]; RE0051704.
RX PUBMED: 9826778.
RA Bailey P., Sartorelli V., Hamamori Y., Muscat G. E.
RT The orphan nuclear receptor, COUP-TF II, inhibits myogenesis by post-transcriptional regulation of MyoD function: COUP-TF II directly interacts with p300 and myoD.
RL Nucleic Acids Res. 26:5501-5510 (1998).
RN [63]; RE0054661.
RX PUBMED: 18782771.
RA Hou T., Ray S., Lee C., Brasier A. R.
RT The STAT3 NH2-terminal Domain Stabilizes Enhanceosome Assembly by Interacting with the p300 Bromodomain.
RL J. Biol. Chem. 283:30725-30734 (2008).
RN [64]; RE0055116.
RX PUBMED: 9436983.
RA Kawasaki H., Song J., Eckner R., Ugai H., Chiu R., Taira K., Shi Y., Jones N., Yokoyama K. K.
RT p300 and ATF-2 are components of the DRF complex, which regulates retinoic acid- and E1A-mediated transcription of the c-jun gene in F9 cells.
RL Genes Dev. 12:233-245 (1998).
RN [65]; RE0055566.
RX PUBMED: 17627840.
RA Zhang Q., Zhang K., Zou Y., Perna A., Wang Y.
RT A quantitative study on the in vitro and in vivo acetylation of high mobility group A1 proteins.
RL J. Am. Soc. Mass Spectrom. 18:1569-1578 (2007).
RN [66]; RE0064992.
RX PUBMED: 11029584.
RA Smit D. J., Smith A. G., Parsons P. G., Muscat G. E., Sturm R. A.
RT Domains of Brn-2 that mediate homodimerization and interaction with general and melanocytic transcription factors.
RL Eur. J. Biochem. 267:6413-6422 (2000).
RN [67]; RE0065790.
RX PUBMED: 19182791.
RA Oh Y. M., Kwon Y. E., Kim J. M., Bae S. J., Lee B. K., Yoo S. J., Chung C. H., Deshaies R. J., Seol J. H.
RT Chfr is linked to tumour metastasis through the downregulation of HDAC1.
RL Nat. Cell Biol. 11:295-302 (2009).
RN [68]; RE0068793.
RX PUBMED: 17382325.
RA Cho H., Ahn D. R., Park H., Yang E. G.
RT Modulation of p300 binding by posttranslational modifications of the C-terminal activation domain of hypoxia-inducible factor-1alpha.
RL FEBS Lett. 581:1542-1548 (2007).
RN [69]; RE0070225.
RX PUBMED: 20810990.
RA Zhang M., Zhang J., Rui J., Liu X.
RT p300-mediated acetylation stabilizes the Th-inducing POK factor.
RL J. Immunol. 185:3960-3969 (2010).
RN [70]; RE0025357.
RX PUBMED: 15295102.
RA Gronroos E., Terentiev A. A., Punga T., Ericsson J.
RT YY1 inhibits the activation of the p53 tumor suppressor in response to genotoxic stress.
RL Proc. Natl. Acad. Sci. USA 101:12165-12170 (2004).
RN [71]; RE0027282.
RX PUBMED: 10942770.
RA Pastorcic M., Das H. K.
RT Regulation of transcription of the human presenilin-1 gene by ets transcription factors and the p53 protooncogene
RL J. Biol. Chem. 275:34938-45 (2000).
XX
//