TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T06006 XX ID T06006 XX DT 09.06.2004 (created); cch. DT 20.02.2006 (updated); rad. CO Copyright (C), QIAGEN. XX FA p73alpha XX SY TAp73alpha. XX OS monkey, Cercopithecus aethiops OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates; haplorhini; catarrhini; cercopithecidae; cercopithecinae XX CL C0057; P53. XX SZ 637 AA; 69.6 kDa (calc.). XX SQ MAQSTTTSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS SQ VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD SQ YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSAPPPPGTAIRAMPV SQ YKKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY SQ EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGR SQ DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGPGVKKRRHGDEDTYYLQVR SQ GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG SQ VNKLPSVNQLVGQPPPHSSAATPNLGPVGSGMLNNHGHAVPANSEMTSSHGTQSMVSGSH SQ CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT SQ IWRGLQDLKQGHDYGAAAQQLLRSSNAAAISIGGSGELQRQRVMEAVHFRVRHTITIPNR SQ GGPGAGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH XX SC translated from EMBL #Y11419 XX FT 24 581 PF00478; IMP dehydrogenase / GMP reductase domain. FT 113 309 PF00870; P53 DNA-binding domain. FT 345 386 PF07710; P53 tetramerisation motif. FT 483 487 interaction with YAP [2]. FT 485 551 PF07647; SAM domain (Sterile alpha motif). FT 485 551 SM00454; SAM. XX SF is very similar to the corresponding human factor; XX FF activator [4]; FF can recruit co-activator p300/CBP [4] [5]; FF can recruit co-activator YAP [2]; XX IN T02214 CBP-isoform1; human, Homo sapiens. IN T01427 p300; human, Homo sapiens. IN T01839 WT1 -KTS; human, Homo sapiens. IN T00900 WT1 I -KTS; human, Homo sapiens. IN T01840 WT1 I; human, Homo sapiens. IN T00899 WT1; human, Homo sapiens. IN T22876 YAP; human, Homo sapiens. XX MX M00761 V$P53DECAMER_Q2. MX M03558 V$P73_Q6. XX BS R11385. BS R11386. XX DR TRANSPATH: MO000042297. DR EMBL: Y11419; DR UniProtKB: Q9XSK8; XX RN [1]; RE0006141. RX PUBMED: 9296498. RA Jost C. A., Marin M. C., Kaelin WG J. r. RT P73 is a simian (correction of human) p53- related protein that can induce apoptosis RL Nature 389:191-194 (1997). RN [2]; RE0024344. RX PUBMED: 11278685. RA Strano S., Munarriz E., Rossi M., Castagnoli L., Shaul Y., Sacchi A., Oren M., Sudol M., Cesareni G., Blandino G. RT Physical interaction with Yes-associated protein enhances p73 transcriptional activity. RL J. Biol. Chem. 276:15164-15173 (2001). RN [3]; RE0024351. RX PUBMED: 10648616. RA Zeng X., Li X., Miller A., Yuan Z., Yuan W., Kwok R. P., Goodman R., Lu H. RT The N-terminal domain of p73 interacts with the CH1 domain of p300/CREB binding protein and mediates transcriptional activation and apoptosis. RL Mol. Cell. Biol. 20:1299-1310 (2000). RN [4]; RE0024370. RX PUBMED: 11076933. RA Zeng X., Lee H., Zhang Q., Lu H. RT p300 does not require its acetylase activity to stimulate p73 function. RL J. Biol. Chem. 276:48-52 (2001). RN [5]; RE0024378. RX PUBMED: 10207051. RA Zeng X., Chen L., Jost C. A., Maya R., Keller D., Wang X., Kaelin WG J. r., Oren M., Chen J., Lu H. RT MDM2 suppresses p73 function without promoting p73 degradation. RL Mol. Cell. Biol. 19:3257-3266 (1999). RN [6]; RE0047316. RX PUBMED: 10469568. RA Ongkeko W. M., Wang X. Q., Siu W. Y., Lau A. W., Yamashita K., Harris A. L., Cox L. S., Poon R. Y. RT MDM2 and MDMX bind and stabilize the p53-related protein p73. RL Curr. Biol. 9:829-832 (1999). XX //