TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01005 XX ID T01005 XX DT 26.01.1994 (created); ewi. DT 22.07.2015 (updated); sla. CO Copyright (C), QIAGEN. XX FA MEF-2A-isoform1 XX SY MEF-2; MEF2; MEF2-Aisoform1; MEF2A-isoform1; Myocyte Enhancer Factor 2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003943 MEF2A; HGNC: MEF2A. XX HO D-MEF2 (Drosophila). XX CL C0014; MADS; 5.1.1.1.1.1. XX SZ 507 AA; 54.8 kDa (cDNA) (calc.). XX SQ MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST SQ DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE SQ EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSML SQ SPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIG SQ ATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR SQ ISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLS SQ LGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ SQ QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSP SQ IVLGRPPNTEDRESPSVKRMRMDAWVT XX SC conceptually translated from EMBL/GenBank/DDBJ #X68505 XX FT 1 60 SM00432; MADS. FT 1 61 PS50066; MADS_BOX_2. FT 9 59 PF00319; SRF-type transcription factor (DNA-binding a. XX SF alternative splicing leads to aMEF-2, RSRFC4, RSRFC9; SF direct interaction with other myogenic factors (bHLH proteins MyoD, myogenin, MRF4), but not with E2 proteins [3]; SF G2E mutant exhibits MCM1-binding specificity [2]; SF heterodimerization with MEF-2D [7]; XX CP cardiac, smooth, skeletal muscle, less in placenta, brain, lung, kidney [1]; P19 cells differentiated into neurons or endodermal cells, undifferentiated P19 cells [6] [1] [6]. CN liver [1]. XX FF activator [1]; FF involved in myogenesis [5] [1]; FF cooperates with myogenic bHLH factors through E-box for gene activation in skeletal muscle cells [3]; FF MADS domain of MEF2A is both necessary and sufficient for binding to MyoD [3]; FF synergistic activation of transcription in neurogenic lineages with MASH1 [6]; FF threonines 312 and 319 are phosphorylation sites for p38 [7] [8]; FF serine 355 is a phosphorylation site for p38 [8]; FF phosphorylation of MEF-2A-isoform1 in a MEF-2A-isoform1/MEF-2D heterodimer enhances MEF-2-dependent gene expression [7]; XX IN T01537 MRF4; mouse, Mus musculus. IN T00525 MyoD; human, Homo sapiens. IN T00526 MyoD; mouse, Mus musculus. IN T00528 myogenin; mouse, Mus musculus. IN T05299 NR1B1; human, Homo sapiens. IN T01427 p300; human, Homo sapiens. IN T28503 pitx2a; Mammalia. IN T10184 T3R-alpha1; Mammalia. XX MX M00403 V$AMEF2_Q6. MX M00406 V$HMEF2_Q6. MX M02024 V$MEF2A_Q6. MX M00006 V$MEF2_01. MX M00231 V$MEF2_02. MX M00232 V$MEF2_03. MX M00233 V$MEF2_04. MX M00941 V$MEF2_Q6_01. MX M07326 V$MEF2_Q6_02. MX M07424 V$MEF2_Q6_03. MX M00405 V$MMEF2_Q6. MX M00026 V$RSRFC4_01. MX M00407 V$RSRFC4_Q2. XX BS R03583. BS R05148. BS R05149. BS R05150. BS R05151. BS R05152. BS R03586. BS R00197. BS R00198. BS R00199. BS R09149. BS R09235. BS R09469. BS R04530. BS R04804. BS R04805. BS R04806. BS R00244. BS R03585. BS R09465. BS R09387. BS R03584. BS R08511. BS R03589. BS R03587. BS R03588. XX DR TRANSPATH: MO000020768. DR TRANSCOMPEL: C00120. DR EMBL: X68505; HSMEF2. DR UniProtKB: Q02078-1; XX RN [1]; RE0000768. RX PUBMED: 1516833. RA Yu Y.-T., Breitbart R. E., Smoot L. B., Lee Y., Mahdavi V., Nadal-Ginard B. RT Human myocyte-specific enhancer factor 2 comprises a group of tissue-restricted MADS box transcription factors RL Genes Dev. 6:1783-1798 (1992). RN [2]; RE0004114. RX PUBMED: 7623803. RA Nurrish S. J., Treisman R. RT DNA binding specificity determinants in MADS-box transcription factors RL Mol. Cell. Biol. 15:4076-4085 (1995). RN [3]; RE0004142. RX PUBMED: 7973707. RA Kaushal S., Schneider J. W., Nadal-Ginard B., Mahdavi V. RT Activation of the myogenic lineage by MEF2A, a factor that induces and cooperates with MyoD RL Science 266:1236-1240 (1994). RN [4]; RE0004143. RX PUBMED: 8524326. RA Fickett J. W. RT Quantitative discrimination of MEF2 sites RL Mol. Cell. Biol. 16:437-441 (1996). RN [5]; RE0010487. RX PUBMED: 7739551. RA Naidu P. S., Ludolph D. C., To R. Q., Hinterberger T. J., Konieczny S. F. RT Myogenin and MEF2 function synergistically to activate the MRF4 promoter during myogenesis RL Mol. Cell. Biol. 15:2707-2718 (1995). RN [6]; RE0015139. RX PUBMED: 8900141. RA Black B.L., Ligon K.L., Zhang Y., Olson E.N. RT Cooperative transcriptional activation by the neurogenic basic helix-loop-helix protein MASH1 and members of the myocyte enhancer factor-2 (MEF2) family RL J. Biol. Chem. 271:26659-26663 (1996). RN [7]; RE0015211. RX PUBMED: 9858528. RA Zhao M., New L., Kravchenko VV., Kato Y., Gram H., di Padova F., Olson E. N., Ulevitch R. J., Han J. RT Regulation of the MEF2 family of transcription factors by p38 RL Mol. Cell. Biol. 19:21-30 (1999). RN [8]; RE0015225. RX PUBMED: 10373581. RA Ornatsky O. I., Cox D. M., Tangirala P., Andreucci J. J., Quinn Z. A., Wrana J. L., Prywes R., Yu Y. T., McDermott J. C. RT Post-translational control of the MEF2A transcriptional regulatory protein RL Nucleic Acids Res. 27:2646-2654 (1999). RN [9]; RE0041786. RX PUBMED: 10849446. RA Kato Y., Zhao M., Morikawa A., Sugiyama T., Chakravortty D., Koide N., Yoshida T., Tapping R. I., Yang Y., Yokochi T., Lee J. D. RT Big mitogen-activated kinase regulates multiple members of the MEF2 protein family RL J. Biol. Chem. 275:18534-40 (2000). RN [10]; RE0048085. RX PUBMED: 15466416. RA Toro R., Saadi I., Kuburas A., Nemer M., Russo A. F. RT Cell-specific activation of the atrial natriuretic factor promoter by PITX2 and MEF2A. RL J. Biol. Chem. 279:52087-52094 (2004). RN [11]; RE0048092. RX PUBMED: 9111345. RA Lee Y., Nadal-Ginard B., Mahdavi V., Izumo S. RT Myocyte-specific enhancer factor 2 and thyroid hormone receptor associate and synergistically activate the alpha-cardiac myosin heavy-chain gene. RL Mol. Cell. Biol. 17:2745-2755 (1997). RN [12]; RE0049297. RX PUBMED: 12371907. RA de Luca A., Severino A., De Paolis P., Cottone G., De Luca L., De Falco M., Porcellini A., Volpe M., Condorelli G. RT p300/cAMP-response-element-binding-protein (CREB)-binding protein (CBP) modulates co-operation between myocyte enhancer factor 2A (MEF2A) and thyroid hormone receptor-retinoid X receptor. RL Biochem. J. 369:477-484 (2003). XX //