TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01537 XX ID T01537 XX DT 30.07.1995 (created); hiwi. DT 23.09.2009 (updated); mku. CO Copyright (C), QIAGEN. XX FA MRF4 XX SY herculin; Myf-6. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001909 Myf6. XX CL C0010; bHLH. XX SZ 242 AA; 27.0 kDa (cDNA) (calc.). XX SQ MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEE SQ HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT SQ VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFL SQ RTCSPQWPSVSDHSRGLVITAKEGGANVDASASSSLQRLSSIVDSISSEERKLPSVEEVV SQ EK XX SC Swiss-Prot#P15375 XX FT 3 93 PF01586; Myogenic Basic domain. FT 3 98 SM00520; BASIC. FT 93 145 PS50888; HLH. FT 94 145 PF00010; Helix-loop-helix DNA-binding domain. FT 99 150 SM00353; finulus. XX CP myogenic cells; skeletal muscle (adult mice ) [1]. CN smooth muscle (adult mice ) [1]. XX FF it is transiently expressed after myogenin, before MyoD, and reappears during late stage of skeletal muscle development; FF during limb bud development, it is expressed just at these late stages [3]; FF Ras proto-oncogene product (Ras p21Val) inhibits myogenic differentiation via targeting the basic domain of MRF4, but without affecting its DNA-binding capability [4]; XX IN T00505 Mef-2A-isoform1; mouse, Mus musculus. IN T01005 MEF-2A-isoform1; human, Homo sapiens. IN T01784 MEF-2A; clawed frog, Xenopus laevis. XX MX M00804 V$E2A_Q2. MX M00973 V$E2A_Q6. MX M01034 V$EBOX_Q6_01. MX M03831 V$MRF4_Q3. MX M02781 V$MYF6_03. MX M02885 V$MYF6_04. MX M00929 V$MYOD_Q6_01. XX DR TRANSPATH: MO000025749. DR EMBL: M30499; DR EMBL: X59060; DR UniProtKB: P15375; XX RN [1]; RE0002421. RX PUBMED: 2300571. RA Miner J. H., Wold B. J. RT Herculin, a fourth member of the MyoD family of myogenic regulatory genes RL Proc. Natl. Acad. Sci. USA 87:1089-1093 (1990). RN [2]; RE0002987. RX PUBMED: 1328851. RA Mak K.-L., To R. Q., Kong Y., Konieczny S. F. RT The MRF4 activation domain is required to induce muscle-specific gene expression RL Mol. Cell. Biol. 12:4334-4346 (1992). RN [3]; RE0003272. RX PUBMED: 2045411. RA Bober E., Lyons G. E., Braun T., Cossu G., Buckingham M., Arnold H. H. RT The muscle regulatory gene, myf-6, has a biphasic pattern of expression during early mouse development RL J. Cell Biol. 113:1255-1265 (1991). RN [4]; RE0005808. RX PUBMED: 7565669. RA Kong Y., Johnson S. E., Taparowsky E. J., Konieczny S. F. RT Ras p21 (Val) inhibits myogenesis without altering the DNA binding or transcriptional activities of the myogenic basic helix-loop-helix factors RL Mol. Cell. Biol. 15:5205-5213 (1995). XX //