TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00505 XX ID T00505 XX DT 21.10.1992 (created); ewi. DT 22.07.2015 (updated); sla. CO Copyright (C), QIAGEN. XX FA Mef-2A-isoform1 XX SY A430079H05Rik; MEF-2; MEF-2A; Mef-2a-isoform1; Mef2-Aisoform1; MEF2A; Mef2a-isoform1; myocyte enhancer factor 2A; myocyte enhancer factor 2A isoform 1; myocyte-specific enhancer factor, alternatively spliced exon. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009776 Mef2a. XX HO D-MEF2 (Drosophila). XX CL C0014; MADS. XX SZ 498 AA; 53.7 kDa (cDNA) (calc.). XX SQ MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST SQ DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCENPDADDYFEHSPLSEDRFIKLNE SQ DSDFIFKRGPPGFPPQNFSMSVTVPVTSPNPLSDTNPGSSLVSPSLAASSTLAETSMLSP SQ PPATLHRNVSPGAPQRPPSTGSASGMLSTTDLTVPNGAGNSPVGNGFVNSRASPNLIGNT SQ GANSLGKVMPTKSPPPPGGGSLGMNSRKPDLRVAIPPSSKGMMPPLSEEEELELNAQRIS SQ SSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFTSPGMLSLG SQ QASAWQEHHLGQTTLSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQHH SQ HHHPQQQPPPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPANT SQ EDRESPSVKRMRMDTWVT XX SC conceptually translated from EMBL/GenBank/DDBJ #U30823 XX FT 1 60 SM00432; MADS. FT 1 61 PS50066; MADS_BOX_2. FT 9 59 PF00319; SRF-type transcription factor (DNA-binding a. XX SF in skeletal and heart muscle cells, MEF-2 recognizes the same sequence motif [4]; SF MEF-2 in brain binds to an extended sequence, possible due to interaction with additional factors [4]; SF gene expression in developing brain see for detailed information [9]; XX CP myogenic cells, brain [1]; developing brain [9] [1] [9]. XX FF involved in myogenesis [6]; FF cooperates with myogenic bHLH factors [6]; FF induces MyoD [6]; FF induced by myogenin [3]; FF cooperates with MyoD through direct interactions and by binding to either MEF-2 sites or to E-box elements [5]; FF expression in cerebellum: begins at postnatal day 6, maintains in adults with highest levels in hippocampus, olfactory bulb, cerebellum [8]; XX IN T01537 MRF4; mouse, Mus musculus. IN T00526 MyoD; mouse, Mus musculus. IN T00528 myogenin; mouse, Mus musculus. XX MX M00403 V$AMEF2_Q6. MX M00406 V$HMEF2_Q6. MX M02024 V$MEF2A_Q6. MX M00006 V$MEF2_01. MX M00231 V$MEF2_02. MX M00232 V$MEF2_03. MX M00233 V$MEF2_04. MX M00941 V$MEF2_Q6_01. MX M07326 V$MEF2_Q6_02. MX M07424 V$MEF2_Q6_03. MX M00405 V$MMEF2_Q6. MX M00026 V$RSRFC4_01. MX M00407 V$RSRFC4_Q2. XX BS R03583. BS R03586. BS R09144. BS R04212. BS R02201. BS R04530. BS R04804. BS R04805. BS R04806. BS R00244. BS R03585. BS R03584. BS R03589. BS R03587. BS R03588. XX DR TRANSPATH: MO000020767. DR EMBL: U30823; MM30823. DR UniProtKB: Q60929-1; MEFA_MOUSE. XX RN [1]; RE0000768. RX PUBMED: 1516833. RA Yu Y.-T., Breitbart R. E., Smoot L. B., Lee Y., Mahdavi V., Nadal-Ginard B. RT Human myocyte-specific enhancer factor 2 comprises a group of tissue-restricted MADS box transcription factors RL Genes Dev. 6:1783-1798 (1992). RN [2]; RE0001228. RX PUBMED: 2601707. RA Gossett L. A., Kelvin D. J., Sternberg E. A., Olson E. N. RT A new myocyte-specific enhancer-binding factor that recognizes a conserved element associated with multiple muscle-specific genes RL Mol. Cell. Biol. 9:5022-5033 (1989). RN [3]; RE0001481. RX PUBMED: 1656214. RA Cserjesi P., Olson E. N. RT Myogenin induces the myocyte-specific enhancer binding factor MEF-2 independently of other muscle-specific gene products RL Mol. Cell. Biol. 11:4854-4862 (1991). RN [4]; RE0003602. RX PUBMED: 7559475. RA Andres V., Cervera M., Mahdavi V. RT Determination of the consensus binding site for MEF2 expressed in muscle and brain reveals tissue-specific sequence constraints RL J. Biol. Chem. 270:23246-23249 (1995). RN [5]; RE0004082. RX PUBMED: 8548800. RA Molkentin J. D., Black B. L., Martin J. F., Olson E. N. RT Cooperative activation of muscle gene expression by MEF2 and myogenic bHLH proteins RL Cell 83:1125-1136 (1995). RN [6]; RE0004142. RX PUBMED: 7973707. RA Kaushal S., Schneider J. W., Nadal-Ginard B., Mahdavi V. RT Activation of the myogenic lineage by MEF2A, a factor that induces and cooperates with MyoD RL Science 266:1236-1240 (1994). RN [7]; RE0004143. RX PUBMED: 8524326. RA Fickett J. W. RT Quantitative discrimination of MEF2 sites RL Mol. Cell. Biol. 16:437-441 (1996). RN [8]; RE0014846. RX PUBMED: 9013788. RA Lin X., Shah S., Bulleit R.F. RT The expression of MEF2 genes is implicated in CNS neuronal differentiation RL Brain Res. Mol. Brain Res. 42:307-316 (1996). RN [9]; RE0015071. RX PUBMED: 7643214. RA Lyons G.E., Micales B.K., Schwarz J., Martin J.F., Olson E.N. RT Expression of mef2 genes in the mouse central nervous system suggests a role in neuronal maturation RL J. Neurosci. 15:5727-5738 (1995). XX //