TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01330 XX ID T01330 XX DT 25.10.1994 (created); ewi. DT 28.09.2007 (updated); bch. CO Copyright (C), QIAGEN. XX FA RAR-gamma1 XX SY RAR-gamma1; retinoic acid receptor gamma1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G000377 RARG; HGNC: rarg. XX CL C0002; CC (rec); 2.1.2.1.3.1. XX SZ 454 AA; 50.3 kDa (cDNA) (calc.). XX SQ MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS SQ LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK SQ NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY SQ ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK SQ IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH SQ NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA SQ LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE SQ MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA XX SC Swiss-Prot#P13631-1 XX FT 87 158 SM00399; c4gold. FT 87 162 PS51030; NUCLEAR_REC_DBD_2. FT 88 163 PF00105; Zinc finger, C4 type (two domains). FT 232 390 SM00430; holi. FT 235 415 PF00104; Ligand-binding domain of nuclear hormon. FT 371 393 helix 10 [9]. FT 398 417 helix 11 [9]. XX FF negative control of AP-1 responsive genes; XX IN T02184 cyclinH; human, Homo sapiens. IN T02187 MAT1; human, Homo sapiens. IN T02186 MO15; human, Homo sapiens. IN T08641 NCOR1-isoform1; mouse, Mus musculus. IN T01427 p300; human, Homo sapiens. IN T01331 RXR-alpha; mouse, Mus musculus. IN T01345 RXR-alpha; human, Homo sapiens. IN T01359 RXR-alpha; clawed frog, Xenopus laevis. IN T08348 RXR-alpha; mouse, Mus musculus. IN T01332 RXR-beta; mouse, Mus musculus. IN T01334 RXR-beta; human, Homo sapiens. IN T01349 RXR-beta; rat, Rattus norvegicus. IN T01333 RXR-gamma; mouse, Mus musculus. IN T01360 RXR-gamma; clawed frog, Xenopus laevis. IN T04639 SRC-1; mouse, Mus musculus. IN T02183 TFIIH-p62; human, Homo sapiens. IN T02181 TFIIH-p90; human, Homo sapiens. XX MX M07280 V$NR1NR2_Q3. XX BS R20826. BS R04075. BS R03962. XX DR TRANSPATH: MO000025589. DR EMBL: M24857; DR EMBL: M38258; DR EMBL: M57707; DR UniProtKB: P13631-1; XX RN [1]; RE0000265. RX PUBMED: 1310259. RA Leid M., Kastner P., Lyons R., Nakshatri H., Saunders M., Zacharewski T., Chen J.-Y., Staub A., Garnier J.-M., Mader S., Chambon P. RT Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently RL Cell 68:377-395 (1992). RN [2]; RE0000554. RX PUBMED: 2176152. RA Nicholson R. C., Mader S., Nagpal S., Leid M., Rochette-Egly C., Chambon P. RT Negative regulation of the rat stromelysin gene promoter by retinoic acid is mediated by an AP1 binding site RL EMBO J. 9:4443-4454 (1990). RN [3]; RE0001917. RX PUBMED: 1310350. RA Zhang X. K., Hoffmann B., Tran P. B.-V., Graupner G., Pfahl M. RT Retinoid X receptor is an auxiliary protein for thyroid hormone and retinoic acid receptors RL Nature 355:441-446 (1992). RN [4]; RE0002566. RX PUBMED: 1648728. RA Schuele R., Rangarajan P., Yang N., Kliewer S., Ransone L. J., Bolado J., Verma I. M., Evans R. M. RT Retinoic acid is a negative regulator of AP-1-responsive genes RL Proc. Natl. Acad. Sci. USA 88:6092-6096 (1991). RN [5]; RE0002567. RX PUBMED: 2546152. RA Krust A., Kastner P., Petkovich M., Zelent A., Chambon P. RT A third human retinoic acid receptor, hRAR-gamma RL Proc. Natl. Acad. Sci. USA 86:5310-5314 (1989). RN [6]; RE0016813. RX PUBMED: 10336495. RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M. RT Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein RL J. Biol. Chem. 274:15901-15907 (1999). RN [7]; RE0040875. RX PUBMED: 9407140. RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M. RT p300 functions as a coactivator for the peroxisome proliferator-activated receptor alpha RL J. Biol. Chem. 272:33435-43 (1997). RN [8]; RE0047743. RX PUBMED: 15610520. RA Flores A. M., Li L., Aneskievich B. J. RT Isolation and functional analysis of a keratinocyte-derived, ligand-regulated nuclear receptor comodulator. RL J. Invest. Dermatol 123:1092-1101 (2004). RN [9]; RE0049022. RX PUBMED: 9660764. RA Chinpaisal C., Lee C. H., Wei L. N. RT Mechanisms of the mouse orphan nuclear receptor TR2-11-mediated gene suppression. RL J. Biol. Chem. 273:18077-18085 (1998). XX //