AC T08348
XX
ID T08348
XX
DT 16.01.2006 (created); jag.
DT 11.12.2015 (updated); sup.
CO Copyright (C), QIAGEN.
XX
FA RXR-alpha
XX
SY NR2B1; retinoid X receptor alpha; RXR-alpha.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G006695 Rxra.
XX
CL C0002; CC (rec).
XX
SZ 467 AA; 51.2 kDa (cDNA) (calc.).
XX
SQ MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLS
SQ SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNG
SQ VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
SQ DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
SQ LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
SQ DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
SQ KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
SQ AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT
XX
SC translated from EMBL #M84817
XX
FT 1 140 region A/B (modulating transactivation functions) [11].
FT 71 464 PF00478; IMP dehydrogenase / GMP reductase domai.
FT 137 208 SM00399; c4gold.
FT 137 212 PS51030; NUCLEAR_REC_DBD_2.
FT 138 213 PF00105; Zinc finger, C4 type (two domains).
FT 140 160 zinc finger 1 (C-X2-C-X13-C-X2-C) [12].
FT 140 205 region C (DNA-binding domain) [11].
FT 158 162 P-Box [12].
FT 176 195 zinc finger 2 (C-X5-C-X9-C-X2-C) [12].
FT 177 181 D-Box [12].
FT 230 467 region E/F (ligand-binding domain, activation function 2) [11].
FT 275 434 SM00430; holi.
FT 278 459 PF00104; Ligand-binding domain of nuclear hormon.
XX
IN T08641 NCOR1-isoform1; mouse, Mus musculus.
IN T09645 Nrf2-isoform1; human, Homo sapiens.
IN T08469 Nrf2; mouse, Mus musculus.
IN T23091 p300; Mammalia.
IN T08172 p54NRB; human, Homo sapiens.
IN T08431 PPARalpha; mouse, Mus musculus.
IN T05351 PPARgamma; human, Homo sapiens.
IN T08891 PSF-isoform1; human, Homo sapiens.
IN T01330 RAR-gamma1; human, Homo sapiens.
IN T14622 sin3a; human, Homo sapiens.
IN T04639 SRC-1; mouse, Mus musculus.
IN T08501 T3R-alpha; chick, Gallus gallus.
IN T13796 TLS; human, Homo sapiens.
IN T08482 VDR-isoform1; human, Homo sapiens.
XX
MX M00966 V$DR3_Q4.
MX M00965 V$DR4_Q2.
MX M07280 V$NR1NR2_Q3.
MX M00518 V$PPARA_02.
MX M02262 V$PPARGRXRA_01.
MX M02791 V$RXRA_03.
MX M02895 V$RXRA_04.
MX M00963 V$T3R_Q6.
XX
BS R14242.
BS R14243.
BS R14244.
BS R14245.
BS R14246.
BS R14247.
BS R14248.
BS R14249.
BS R14250.
BS R14251.
BS R14252.
BS R14253.
BS R14254.
BS R14255.
BS R14256.
BS R03930.
BS R04810.
BS R11628.
BS R11634.
BS R11635.
BS R14238.
BS R03935.
BS R03936.
BS R04768.
XX
DR TRANSPATH: MO000056800.
DR EMBL: M84817;
DR EMBL: X66223;
DR UniProtKB: P28700;
XX
RN [1]; RE0012601.
RX PUBMED: 8668150.
RA Vu-Dac N., Schoonjans K., Kosykh V., Dallongeville J., Heyman R. A., Staels B., Auwerx J.
RT Retinoids increase human apolipoprotein A-II expression through activation of the retinoid x receptor but not the retinoic acid receptor
RL Mol. Cell. Biol. 16:3350-3360 (1996).
RN [2]; RE0016813.
RX PUBMED: 10336495.
RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M.
RT Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein
RL J. Biol. Chem. 274:15901-15907 (1999).
RN [3]; RE0037964.
RX PUBMED: 9795230.
RA Masuda N., Yasumo H., Furusawa T., Tsukamoto T., Sadano H., Osumi T.
RT Nuclear receptor binding factor-1 (NRBF-1), a protein interacting with a wide spectrum of nuclear hormone receptors
RL Gene 221:225-33 (1998).
RN [4]; RE0039941.
RX PUBMED: 11682061.
RA Bastie J. N., Despouy G., Balitrand N., Rochette-Egly C., Chomienne C., Delva L.
RT The novel co-activator CRABPII binds to RARalpha and RXRalpha via two nuclear receptor interacting domains and does not require the AF-2 'core'
RL FEBS Lett. 507:67-73 (2001).
RN [5]; RE0040875.
RX PUBMED: 9407140.
RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M.
RT p300 functions as a coactivator for the peroxisome proliferator-activated receptor alpha
RL J. Biol. Chem. 272:33435-43 (1997).
RN [6]; RE0042891.
RX PUBMED: 12198243.
RA Brendel C., Schoonjans K., Botrugno O. A., Treuter E., Auwerx J.
RT The Small Heterodimer Partner Interacts with the Liver X Receptor alpha and Represses Its Transcriptional Activity
RL Mol. Endocrinol. 16:2065-76 (2002).
RN [7]; RE0047677.
RX PUBMED: 11259580.
RA Mathur M., Tucker P. W., Samuels H. H.
RT PSF is a novel corepressor that mediates its effect through Sin3A and the DNA binding domain of nuclear hormone receptors.
RL Mol. Cell. Biol. 21:2298-2311 (2001).
RN [8]; RE0047710.
RX PUBMED: 9440806.
RA Powers C. A., Mathur M., Raaka B. M., Ron D., Samuels H. H.
RT TLS (translocated-in-liposarcoma) is a high-affinity interactor for steroid, thyroid hormone, and retinoid receptors.
RL Mol. Endocrinol. 12:4-18 (1998).
RN [9]; RE0047810.
RX PUBMED: 14701856.
RA Debril M. B., Gelman L., Fayard E., Annicotte J. S., Rocchi S., Auwerx J.
RT Transcription factors and nuclear receptors interact with the SWI/SNF complex through the BAF60c subunit.
RL J. Biol. Chem. 279:16677-16686 (2004).
RN [10]; RE0053029.
RX PUBMED: 12796488.
RA Yamamoto H., Shevde N. K., Warrier A., Plum L. A., DeLuca H. F., Pike J. W.
RT 2-Methylene-19-nor-(20S)-1,25-dihydroxyvitamin D3 potently stimulates gene-specific DNA binding of the vitamin D receptor in osteoblasts.
RL J. Biol. Chem. 278:31756-31765 (2003).
RN [11]; RE0000789.
RX PUBMED: 1312497.
RA Mangelsdorf D. J., Borgmeyer U., Heyman R. A., Zhou J. Y., Ong E. S., Oro A. E., Kakizuka A., Evans R. M.
RT Characterization of three RXR genes that mediate the action of 9-cis retinoic acid
RL Genes Dev. 6:329-344 (1992).
RN [12]; RE0000793.
RX PUBMED: 8392478.
RA Perlmann T., Rangarajan P. N., Umesono K., Evans R. M.
RT Determinants for selective RAR and TR recognition of direct repeat HREs
RL Genes Dev. 7:1411-1422 (1993).
XX
//