TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08501 XX ID T08501 XX DT 30.01.2006 (created); din. DT 14.01.2015 (updated); jmh. CO Copyright (C), QIAGEN. XX FA T3R-alpha XX SY c-ErbA; c-ErbA-alpha; NR1A1; T3R; T3R-alpha; THRA; thyroid hormone receptor; thyroid hormone receptor alpha; TR; TRalpha. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G031448 THRA. XX CL C0002; CC (rec). XX SZ 408 AA; 46.8 kDa (cDNA) (calc.). XX SQ MEQKPSTLDPLSEPEDTRWLDGKRKRKSSQCLVKSSMSGYIPSYLDKDEQCVVCGDKATG SQ YHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDGCCVIDKITRNQCQLCRFKKCISVGMAM SQ DLVLDDSKRVAKRKLIEENRERRRKEEMIKSLQHRPSPSAEEWELIHVVTEAHRSTNAQG SQ SHWKQKRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSEL SQ PCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDL SQ GKSLSAFNLDDTEVALLQAVLLMSSDRTGLICVDKIEKCQETYLLAFEHYINYRKHNIPH SQ FWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV XX SC translated from EMBL #Y00987 XX FT 48 121 SM00399; c4gold. FT 48 125 PS51030; NUCLEAR_REC_DBD_2. FT 49 126 PF00105; Zinc finger, C4 type (two domains). FT 87 327 PF00478; IMP dehydrogenase / GMP reductase domai. FT 218 376 SM00430; holi. FT 221 402 PF00104; Ligand-binding domain of nuclear hormon. XX IN T08796 ASC-2; human, Homo sapiens. IN T09920 CREB1; Mammalia. IN T08865 ctcf-isoform1; human, Homo sapiens. IN T02285 ctcf; mouse, Mus musculus. IN T25707 FUS-L; human, Homo sapiens. IN T08490 MO15; human, Homo sapiens. IN T04687 NCOR1; human, Homo sapiens. IN T00671 p53; human, Homo sapiens. IN T01516 Pit-1B; rat, Rattus norvegicus. IN T08891 PSF-isoform1; human, Homo sapiens. IN T08348 RXR-alpha; mouse, Mus musculus. IN T01349 RXR-beta; rat, Rattus norvegicus. IN T14622 sin3a; human, Homo sapiens. IN T19112 SMRT-xbb2; human, Homo sapiens. IN T08781 SRB7; human, Homo sapiens. IN T21552 SRC-1; Mammalia. IN T08256 SRC-1A; human, Homo sapiens. IN T08500 SRC3-xbb1; human, Homo sapiens. IN T15900 SREBP-1; chick, Gallus gallus. IN T08439 TIF2; mouse, Mus musculus. IN T13796 TLS; human, Homo sapiens. IN T19456 ZNF277; human, Homo sapiens. XX MX M01724 V$T3RALPHA_Q6. MX M00963 V$T3R_Q6. XX BS R03943. BS R20561. BS R20562. BS R20567. BS R27672. BS R02019. BS R03946. BS R03947. BS R03948. BS R03949. BS R03950. BS R03951. BS R04808. BS R11623. BS R11625. BS R11628. BS R11630. BS R11631. BS R11632. BS R11633. BS R11634. BS R11635. BS R10034. BS R04090. BS R01673. BS R38689. BS R20190. BS R03956. BS R28235. BS R29449. BS R20170. BS R29251. BS R29341. BS R65765. BS R30887. BS R30888. BS R08504. BS R29247. BS R60510. BS R29372. BS R65764. BS R65766. BS R29253. BS R20554. BS R60517. BS R29570. BS R38691. BS R19722. BS R29451. BS R04185. XX DR TRANSPATH: MO000059132. DR EMBL: Y00987; DR UniProtKB: P04625; XX RN [1]; RE0047519. RX PUBMED: 15249124. RA Nevado J., Tenbaum S. P., Aranda A. RT hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor. RL Mol. Cell. Endocrinol. 222:41-51 (2004). RN [2]; RE0047527. RX PUBMED: 10866662. RA Mahajan M. A., Samuels H. H. RT A new family of nuclear receptor coregulators that integrate nuclear receptor signaling through CREB-binding protein. RL Mol. Cell. Biol. 20:5048-5063 (2000). RN [3]; RE0047643. RX PUBMED: 10625678. RA Perez-Juste G., Garcia-Silva S., Aranda A. RT An element in the region responsible for premature termination of transcription mediates repression of c-myc gene expression by thyroid hormone in neuroblastoma cells. RL J. Biol. Chem. 275:1307-1314 (2000). RN [4]; RE0047677. RX PUBMED: 11259580. RA Mathur M., Tucker P. W., Samuels H. H. RT PSF is a novel corepressor that mediates its effect through Sin3A and the DNA binding domain of nuclear hormone receptors. RL Mol. Cell. Biol. 21:2298-2311 (2001). RN [5]; RE0047681. RX PUBMED: 9372952. RA Qi J. S., Desai-Yajnik V., Yuan Y., Samuels H. H. RT Constitutive activation of gene expression by thyroid hormone receptor results from reversal of p53-mediated repression. RL Mol. Cell. Biol. 17:7195-7207 (1997). RN [6]; RE0047685. RX PUBMED: 10490654. RA Li D., Desai-Yajnik V., Lo E., Schapira M., Abagyan R., Samuels H. H. RT NRIF3 is a novel coactivator mediating functional specificity of nuclear hormone receptors. RL Mol. Cell. Biol. 19:7191-7202 (1999). RN [7]; RE0047692. RX PUBMED: 12805224. RA Mendez-Pertuz M., Sanchez-Pacheco A., Aranda A. RT The thyroid hormone receptor antagonizes CREB-mediated transcription. RL EMBO J. 22:3102-3112 (2003). RN [8]; RE0047710. RX PUBMED: 9440806. RA Powers C. A., Mathur M., Raaka B. M., Ron D., Samuels H. H. RT TLS (translocated-in-liposarcoma) is a high-affinity interactor for steroid, thyroid hormone, and retinoid receptors. RL Mol. Endocrinol. 12:4-18 (1998). RN [9]; RE0067795. RX PUBMED: 18187603. RA Yamauchi M., Kambe F., Cao X., Lu X., Kozaki Y., Oiso Y., Seo H. RT Thyroid hormone activates adenosine 5'-monophosphate-activated protein kinase via intracellular calcium mobilization and activation of calcium/calmodulin-dependent protein kinase kinase-beta. RL Mol. Endocrinol. 22:893-903 (2008). XX //