TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08439 XX ID T08439 XX DT 19.01.2006 (created); rad. DT 22.12.2014 (updated); spk. CO Copyright (C), QIAGEN. XX FA TIF2 XX SY glucocorticoid receptor interacting protein 1; GRIP1; NCoA-2; NCOA2; nuclear receptor coactivator 2; SRC-2; TIF2; transcriptional intermediary factor 2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005150 Ncoa2. XX CL C0010; bHLH. XX SZ 1462 AA; 158.5 kDa (cDNA) (calc.). XX SQ MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELADLIFANFNDI SQ DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML SQ EALDGFFFVVNLEGSVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSM SQ VNGGSWSGEPPRRTSHTFNCRMLVKPLPDSEEEGHDSQEAHQKYEAMQCFAVSQPKSIKE SQ EGEDLQSCLICVARRVPMKERPTLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV SQ RRCIQKFHTQHEGESLSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT SQ TNEPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHQALCSGNPGQDMTLG SQ SNINFPMNGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG SQ QASSVLSPRQRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL SQ SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA SQ EASCHPEEQKGPNDSSMPQAASGDRAEGHSRLHDSKGQTKLLQLLTTKSDQMEPSPLPSS SQ LSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESS SQ STAPGSEVTVKQEPASPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK SQ LIAMKTVKEEVSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPTGSVDKQAII SQ NDLMQLTADSSPVPPAGAQKAALRMSQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG SQ PFPPIRNSSPYSVIPQPGMMGNQGMLGSQGNLGNNSTGMIGSSTSRPSMPSGEWAPQSPA SQ VRVTCAATTGAMNRPVQGGMIRNPTASIPMRANSQPGQRQMLQSQVMNIGPSELEMNMGG SQ PQYNQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL SQ DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDAEQFSSQESSIMLEQKPPVFPQQYASQ SQ AQMAQGGYNPMQDPNFHTMGQRPNYTTLRMQPRPGLRPTGIVQNQPNQLRLQLQHRLQAQ SQ QNRQPLMNQISSVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMQQQVQQRT SQ LMMRGQGLNVTPSMVAPAGLPAAMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQ SQ SPLMSPRMAHTQSPMMQQSQANPAYQPTSDMNGWAQGSMGGNSMFSQQSPPHFGQQANTS SQ MYSNNMNISVSMATNTGGLSSMNQMTCQMSMTSVTSVPTSGLPSMGPEQVNDPALRGGNL SQ FPNQLPGMDMIKQEGDASRKYC XX SC translated from EMBL #U39060 XX FT 16 84 PS50888; HLH. FT 32 89 SM00353; finulus. FT 56 1441 PF00478; IMP dehydrogenase / GMP reductase domain. FT 114 181 SM00091; pas_2. FT 119 183 PS50112; PAS. FT 1279 1336 PF07469; Domain of unknown function (DUF1518). XX IN T10341 (VDR-isoform1)2; human, Homo sapiens. IN T05076 GR; human, Homo sapiens. IN T00372 HNF-4alpha1; rat, Rattus norvegicus. IN T02422 HNF-4alpha2; rat, Rattus norvegicus. IN T01427 p300; human, Homo sapiens. IN T02745 PPARdelta; human, Homo sapiens. IN T17618 RXR-alpha:VDR-isoform1; human, Homo sapiens. IN T24830 Smad2; Mammalia. IN T08501 T3R-alpha; chick, Gallus gallus. IN T01692 T3R-beta1; chick, Gallus gallus. IN T01693 T3R-beta2; chick, Gallus gallus. IN T08264 T3R-beta; human, Homo sapiens. IN T08482 VDR-isoform1; human, Homo sapiens. IN T00885 VDR; human, Homo sapiens. IN T09401 VDR; mouse, Mus musculus. XX DR TRANSPATH: MO000057807. DR EMBL: U39060; DR UniProtKB: Q61026; NCOA2_MOUSE. XX RN [1]; RE0031544. RX PUBMED: 11250942. RA Issa L. L., Leong G. M., Barry J. B., Sutherland R. L., Eisman J. A. RT Glucocorticoid receptor-interacting protein-1 and receptor-associated coactivator-3 differentially interact with the vitamin D receptor (VDR) and regulate VDR-retinoid X receptor transcriptional cross-talk. RL Endocrinology 142:1606-15 (2001). RN [2]; RE0033105. RX PUBMED: 15001550. RA Lim H. J., Moon I., Han K. RT Transcriptional cofactors exhibit differential preference toward peroxisome proliferator-activated receptors alpha and delta in uterine cells. RL Endocrinology 145:2886-95 (2004). RN [3]; RE0047657. RX PUBMED: 11435616. RA Yang Z., Privalsky M. L. RT Isoform-specific transcriptional regulation by thyroid hormone receptors: hormone-independent activation operates through a steroid receptor mode of co-activator interaction. RL Mol. Endocrinol. 15:1170-1185 (2001). RN [4]; RE0047715. RX PUBMED: 11266503. RA Zilliacus J., Holter E., Wakui H., Tazawa H., Treuter E., Gustafsson J. A. RT Regulation of glucocorticoid receptor activity by 14--3-3-dependent intracellular relocalization of the corepressor RIP140. RL Mol. Endocrinol. 15:501-511 (2001). RN [5]; RE0048210. RX PUBMED: 15988012. RA Chen Y. H., Kim J. H., Stallcup M. R. RT GAC63, a GRIP1-dependent nuclear receptor coactivator. RL Mol. Cell. Biol. 25:5965-5972 (2005). RN [6]; RE0048215. RX PUBMED: 12351636. RA Teyssier C., Chen D., Stallcup M. R. RT Requirement for multiple domains of the protein arginine methyltransferase CARM1 in its transcriptional coactivator function. RL J. Biol. Chem. 277:46066-46072 (2002). RN [7]; RE0048277. RX PUBMED: 15731352. RA Lee Y. H., Coonrod S. A., Kraus W. L., Jelinek M. A., Stallcup M. R. RT Regulation of coactivator complex assembly and function by protein arginine methylation and demethylimination. RL Proc. Natl. Acad. Sci. USA 102:3611-3616 (2005). RN [8]; RE0048886. RX PUBMED: 11117528. RA Webb P., Anderson C. M., Valentine C., Nguyen P., Marimuthu A., West B. L., Baxter J. D., Kushner P. J. RT The nuclear receptor corepressor (N-CoR) contains three isoleucine motifs (I/LXXII) that serve as receptor interaction domains (IDs). RL Mol. Endocrinol. 14:1976-1985 (2000). RN [9]; RE0049300. RX PUBMED: 16461774. RA Lee D. Y., Northrop J. P., Kuo M. H., Stallcup M. R. RT Histone H3 lysine 9 methyltransferase G9a is a transcriptional coactivator for nuclear receptors. RL J. Biol. Chem. 281:8476-8485 (2006). RN [10]; RE0051638. RX PUBMED: 10490591. RA Sladek F. M., Ruse MD J. r., Nepomuceno L., Huang S. M., Stallcup M. R. RT Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. RL Mol. Cell. Biol. 19:6509-6522 (1999). RN [11]; RE0051855. RX PUBMED: 10809746. RA Chen S., Cui J., Nakamura K., Ribeiro R. C., West B. L., Gardner D. G. RT Coactivator-vitamin D receptor interactions mediate inhibition of the atrial natriuretic peptide promoter. RL J. Biol. Chem. 275:15039-15048 (2000). RN [12]; RE0051975. RX PUBMED: 11075811. RA Liu Y. Y., Nguyen C., Peleg S. RT Regulation of ligand-induced heterodimerization and coactivator interaction by the activation function-2 domain of the vitamin D receptor. RL Mol. Endocrinol. 14:1776-1787 (2000). RN [13]; RE0051983. RX PUBMED: 12529369. RA Barry J. B., Leong G. M., Church W. B., Issa L. L., Eisman J. A., Gardiner E. M. RT Interactions of SKIP/NCoA-62, TFIIB, and retinoid X receptor with vitamin D receptor helix H10 residues. RL J. Biol. Chem. 278:8224-8228 (2003). RN [14]; RE0054280. RX PUBMED: 17336575. RA Chang Y. L., Huang C. J., Chan J. Y., Liu P. Y., Chang H. P., Huang S. M. RT Regulation of nuclear receptor and coactivator functions by the carboxyl terminus of ubiquitin-conjugating enzyme 9. RL Int. J. Biochem. Cell Biol. 39:1035-1046 (2007). XX //