TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01692 XX ID T01692 XX DT 23.02.1996 (created); ewi. DT 08.12.2009 (updated); jig. CO Copyright (C), QIAGEN. XX FA T3R-beta1 XX SY NR1A2; T3R-beta; T3R-beta1; thyroid hormone receptor beta; thyroid hormone receptor-beta1; TR. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G031658 THRB. XX CL C0002; CC (rec). XX SZ 369 AA; 42.1 kDa (cDNA) (calc.). XX SQ MSGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYEGKCV SQ IDKVTRNQCQECRFKKCIFVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKTMGHKP SQ EPTDEEWELIKIVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSQF SQ TKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNG SQ EMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLVCVERI SQ EKCQEGFLLAFEHYINYRKHHVAHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFP SQ PLFLEVFED XX SC Swiss-Prot#P68306-1 XX FT 12 85 SM00399; c4gold. FT 12 89 PS51030; NUCLEAR_REC_DBD_2. FT 13 90 PF00105; Zinc finger, C4 type (two domains). FT 45 291 PF00478; IMP dehydrogenase / GMP reductase domai. FT 182 340 SM00430; holi. FT 185 366 PF00104; Ligand-binding domain of nuclear hormon. XX SF splice variant: T3R-beta2; XX CP cerebellum: white matter, granule cells. XX FF sharply induced after E19 in brain; FF may have a function in late, hormone-dependent glial and neuronal maturation [1]; XX IN T01332 RXR-beta; mouse, Mus musculus. IN T01334 RXR-beta; human, Homo sapiens. IN T01349 RXR-beta; rat, Rattus norvegicus. IN T08256 SRC-1A; human, Homo sapiens. IN T08439 TIF2; mouse, Mus musculus. IN T01355 TRAP; human, Homo sapiens. XX MX M02119 V$T3RBETA_Q6_01. MX M00963 V$T3R_Q6. XX BS R01465. BS R03942. BS R03102. BS R02595. BS R00619. BS R02694. BS R02695. BS R02696. BS R03523. XX DR TRANSPATH: MO000025874. DR EMBL: M65207; DR EMBL: X17504; DR UniProtKB: P68306-1; XX RN [1]; RE0000466. RX PUBMED: 1991448. RA Forrest D., Hallboeoek F., Persson H., Vennstroem B. RT Distinct functions for thyroid hormone receptors alpha and beta in brain development indicated by differential expression of receptor genes RL EMBO J. 10:269-275 (1991). RN [2]; RE0003848. RX PUBMED: 1970296. RA Forrest D., Sjoeberg M., Vennstroem B. RT Contrasting developmental and tissue-specific expression of alpha and beta thyroid hormone receptors RL EMBO J. 9:1519-1528 (1990). RN [3]; RE0003849. RX PUBMED: 1707280. RA Showers M. O., Darling D. S., Kieffer G. D., Chin W. W. RT Isolation and characterization of a cDNA encoding a chicken beta thyroid hormone receptor RL DNA Cell Biol. 10:211-221 (1991). RN [4]; RE0047657. RX PUBMED: 11435616. RA Yang Z., Privalsky M. L. RT Isoform-specific transcriptional regulation by thyroid hormone receptors: hormone-independent activation operates through a steroid receptor mode of co-activator interaction. RL Mol. Endocrinol. 15:1170-1185 (2001). XX //