TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00372 XX ID T00372 XX DT 26.01.1993 (created); hse. DT 27.02.2013 (updated); uat. CO Copyright (C), QIAGEN. XX FA HNF-4alpha1 XX SY ARE protein; hepatocyte nuclear factor 4; hepatocyte nuclear factor 4alpha1; HNF-4; HNF4; NR2A1. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004820 Hnf4a. XX CL C0002; CC (rec). XX SZ 455 AA; 50.5 kDa (cDNA) (calc.), 54 kDa (SDS) XX SQ MDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNSSNSLGVSALCAICGDRATG SQ KHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEA SQ VQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKRIASITDVCE SQ SMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDY SQ IVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGKIK SQ RLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNL SQ LQEMLLGGSASDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMSTPETPQPSPPS SQ GSGSESYKLLPGAITTIVKPPSAIPQPTITKQEAI XX SC edited Swiss-Prot #P22449 XX FT 48 119 SM00399; c4gold. FT 48 123 PS51030; NUCLEAR_REC_DBD_2. FT 49 124 PF00105; Zinc finger, C4 type (two domains). FT 117 127 T box [11]. FT 117 377 PF00478; IMP dehydrogenase / GMP reductase domai. FT 129 135 A box, PKA phosphorylation recognition site [11]. FT 180 339 SM00430; holi. FT 183 364 PF00104; Ligand-binding domain of nuclear hormon. FT 337 371 putative AF-2 region (by homology) [6]. FT 346 389 essential for trans-activation [6]. XX SF forms homodimers; XX CP liver, kidney, intestine. XX FF transcriptional activator [7] [9] [10] [6]; FF may be antagonized by ARP-1 and/or COUP-TF [7] [5]; FF first step of activation by HNF-4 appears to involve recruitment of TFIIB, a second step operates through the AF-2-homologous activation domain [6]; FF can act as transcriptional activator (e. g. the Fabpi promoter) affected by other upstream elements and transcription factors [9]; FF generally binds to DR1 - two direct repeats AGGTCA separated by a single nucleotide, the same sequence as PPARs and COUPs; FF binds to the transcriptional coactivator PC4 [10]; XX IN T02139 PC4; rat, Rattus norvegicus. IN T08256 SRC-1A; human, Homo sapiens. IN T02159 TFIIB; rat, Rattus norvegicus. IN T08439 TIF2; mouse, Mus musculus. XX MX M00158 V$COUP_01. MX M00762 V$DR1_Q3. MX M00638 V$HNF4ALPHA_Q6. MX M07321 V$HNF4A_Q3. MX M00764 V$HNF4DR1_Q3. MX M00134 V$HNF4_01. MX M00411 V$HNF4_01_B. MX M00967 V$HNF4_Q6. MX M01031 V$HNF4_Q6_01. MX M01032 V$HNF4_Q6_02. MX M01033 V$HNF4_Q6_03. MX M03828 V$HNF4_Q6_04. XX BS R07440. BS R07441. BS R07442. BS R07443. BS R07444. BS R07445. BS R07446. BS R07447. BS R07448. BS R07449. BS R07450. BS R07451. BS R07452. BS R09367. BS R09368. BS R09369. BS R09370. BS R09371. BS R09372. BS R09373. BS R09374. BS R09375. BS R09376. BS R09377. BS R09378. BS R09379. BS R09380. BS R09381. BS R09382. BS R09383. BS R09384. BS R09385. BS R31338. BS R32872. BS R04591. BS R20331. BS R02179. BS R00114. BS R12993. BS R01612. BS R02657. BS R08883. BS R31342. BS R13208. BS R13209. BS R15918. BS R15920. BS R68618. BS R72887. BS R01457. BS R21635. BS R04770. BS R03034. BS R03035. BS R31339. BS R74090. BS R08877. BS R03881. BS R13031. BS R01183. BS R01186. BS R13035. BS R13032. BS R04031. BS R13033. XX DR TRANSPATH: MO000024884. DR TRANSCOMPEL: C00122. DR TRANSCOMPEL: C00123. DR TRANSCOMPEL: C00129. DR TRANSCOMPEL: C00283. DR TRANSCOMPEL: C00369. DR TRANSCOMPEL: C00638. DR EMBL: X57133; DR UniProtKB: P22449; HNF4_RAT. XX RN [1]; RE0000678. RX PUBMED: 2279702. RA Sladek F. M., Zhong W., Lai E., Darnell jr J. E. RT Liver-enriched transcription factor HNF-4 is a novel member of the steroid hormone receptor superfamily RL Genes Dev. 4:2353-2365 (1990). RN [2]; RE0000786. RX PUBMED: 1748280. RA Tian J.-M., Schibler U. RT Tissue-specific expression of the gene encoding hepatocyte nuclear factor 1 may involve hepatocyte nuclear factor 4 RL Genes Dev. 5:2225-2234 (1991). RN [3]; RE0001457. RX PUBMED: 2325638. RA Paulson K. E., Darnell J. E., Rushmore T., Pickett C. B. RT Analysis of the upstream elements of the xenobiotic compound-inducible and positionally regulated glutathione S-transferase Ya gene RL Mol. Cell. Biol. 10:1841-1852 (1990). RN [4]; RE0001476. RX PUBMED: 2786140. RA Costa R. H., Grayson D. R., Darnell J. E. RT Multiple hepatocyte-enriched nuclear factors function in the regulation of transthyretin and alpha1-antitrypsin genes RL Mol. Cell. Biol. 9:1415-1425 (1989). RN [5]; RE0003072. RX PUBMED: 1312668. RA Mietus-Snyder M., Sladek F. M., Ginsburg G. S., Kuo C. F., Ladias J. A. A., Darnell jr J. E., Karathanasis S. K. RT Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells RL Mol. Cell. Biol. 12:1708-1718 (1992). RN [6]; RE0006836. RX PUBMED: 8657158. RA Malik S., Karathanasis S. K. RT TFIIB-directed transcriptional activation by the Orphan nuclear receptor hepatocyte nuclear factor 4 RL Mol. Cell. Biol. 16:1824-1831 (1996). RN [7]; RE0010509. RX PUBMED: 7891708. RA Galson D. L., Tsuchiya T., Tendler D. S., Huang L. E., Ren Y., Ogura T., Bunn H. F. RT The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1 RL Mol. Cell. Biol. 15:2135-2144 (1995). RN [8]; RE0013346. RX PUBMED: 9592157. RA Fraser J. D., Martinez V., Straney R., Briggs M. R. RT DNA binding and transcription activation specificity of hepatocyte nuclear factor 4 RL Nucleic Acids Res. 26:2702-2707 (1998). RN [9]; RE0014411. RX PUBMED: 8505324. RA Rottman J. N., Gordon J. I. RT Comparison of the patterns of expression of rat intestinal fatty acid binding protein/human growth hormone fusion genes in cultured intestinal epithelial cell lines and in the gut epithelium of transgenic mice RL J. Biol. Chem. 268:11994-12002 (1993). RN [10]; RE0018053. RX PUBMED: 11741883. RA Guo H., Cai C. Q., Kuo P. C. RT Hepatocyte nuclear factor-4alpha mediates redox sensitivity of inducible nitric-oxide synthase gene transcription. RL J. Biol. Chem. 277:5054-5060 (2002). RN [11]; RE0018065. RX PUBMED: 9234678. RA Viollet B., Kahn A., Raymondjean M. RT Protein kinase A-dependent phosphorylation modulates DNA-binding activity of hepatocyte nuclear factor 4. RL Mol. Cell. Biol. 17:4208-4219 (1997). RN [12]; RE0053233. RX PUBMED: 10993727. RA Bogan A. A., Dallas-Yang Q., Ruse MD J. r., Maeda Y., Jiang G., Nepomuceno L., Scanlan T. S., Cohen F. E., Sladek F. M. RT Analysis of protein dimerization and ligand binding of orphan receptor HNF4alpha. RL J. Mol. Biol. 302:831-851 (2000). XX //