AC T08482
XX
ID T08482
XX
DT 25.01.2006 (created); res.
DT 17.09.2014 (updated); yre.
CO Copyright (C), QIAGEN.
XX
FA VDR-isoform1
XX
SY 1,25-dihydroxyvitamin D3 receptor; NR1I1; VDR; VDR-M1; vitamin D receptor; Vitamin D3 Receptor.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002933 VDR; HGNC: VDR.
XX
CL C0002; CC (rec).
XX
SZ 427 AA; 48.3 kDa (cDNA) (calc.).
XX
SQ MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
SQ PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
SQ RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
SQ DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
SQ VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
SQ TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
SQ NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
SQ VFGNEIS
XX
SC translated from EMBL #J03258
XX
FT 1 3 
lacking in the allelic variant described by [1].
FT 21 92 
SM00399; c4gold.
FT 21 96 
PS51030; NUCLEAR_REC_DBD_2.
FT 22 97 
PF00105; Zinc finger, C4 type (two domains).
FT 49 55 
nuclear localization signal (RRSMKRK), functional [4].
FT 90 101 
T-box [2].
FT 102 108 
A-box [2].
FT 124 427 
ligand-binding domain [3].
FT 232 394 
SM00430; holi.
FT 235 421 
PF00104; Ligand-binding domain of nuclear hormon.
FT 373 403 contains region that contacts SKIP T04597 [5].
FT 416 427 AF-2 (activation function 2) domain [10].
XX
IN T34290 Alien; human, Homo sapiens.
IN T14315 AML1; Mammalia.
IN T08796 ASC-2; human, Homo sapiens.
IN T14513 beta-catenin; Mammalia.
IN T09920 CREB1; Mammalia.
IN T33929 DRIP205-isoform1; human, Homo sapiens.
IN T17105 FXR; Mammalia.
IN T08490 MO15; human, Homo sapiens.
IN T23095 MTG8; Mammalia.
IN T08641 NCOR1-isoform1; mouse, Mus musculus.
IN T04688 NCOR1; mouse, Mus musculus.
IN T10361 Oct-2; Mammalia.
IN T05295 PGC-1-isoform1; human, Homo sapiens.
IN T01516 Pit-1B; rat, Rattus norvegicus.
IN T14288 PLZF; Mammalia.
IN T08628 POU2F1; Mammalia.
IN T27173 Rbp2-isoform1; human, Homo sapiens.
IN T08348 RXR-alpha; mouse, Mus musculus.
IN T08433 RXR-alpha; human, Homo sapiens.
IN T09964 RXR-alpha; Mammalia.
IN T01334 RXR-beta; human, Homo sapiens.
IN T08728 SKIP; human, Homo sapiens.
IN T04632 SRC-1; human, Homo sapiens.
IN T04639 SRC-1; mouse, Mus musculus.
IN T21552 SRC-1; Mammalia.
IN T22422 SRC3-xbb2; human, Homo sapiens.
IN T08496 TFIIB; human, Homo sapiens.
IN T17428 TFIIB; Mammalia.
IN T08439 TIF2; mouse, Mus musculus.
XX
MX M00966 V$DR3_Q4.
MX M00444 V$VDR_Q3.
MX M00961 V$VDR_Q6.
MX M03569 V$VDR_Q6_01.
XX
BS R11704.
BS R11714.
BS R11715.
BS R11716.
BS R11717.
BS R11718.
BS R11719.
BS R24982.
BS R24988.
BS R10023.
BS R10041.
BS R10018.
BS R10026.
BS R23147.
BS R10031.
BS R30123.
BS R38699.
BS R12727.
BS R24979.
BS R10067.
BS R35862.
BS R10017.
BS R10053.
BS R39101.
BS R10003.
BS R34964.
BS R19317.
BS R01188.
BS R10068.
BS R20610.
BS R11773.
BS R11775.
BS R10022.
BS R02261.
XX
DR TRANSPATH: MO000058742.
DR EMBL: J03258; HSVDR.
DR EMBL: X67482; HSVD3R.
DR UniProtKB: P11473-1;
XX
RN [1]; RE0015312.
RX PUBMED: 8392085.
RA Kristjansson K., Rut A. R., Hewison M., O'Riordan J. L., Hughes M. R.
RT Two mutations in the hormone binding domain of the vitamin D receptor cause tissue resistance to 1,25 dihydroxyvitamin D3
RL J. Clin. Invest. 92:12-16 (1993).
RN [2]; RE0015355.
RX PUBMED: 10587460.
RA Hsieh J. C., Whitfield G. K., Oza A. K., Dang H. T., Price J. N., Galligan M. A., Jurutka P. W., Thompson P. D., Haussler C. A., Haussler M. R.
RT Characterization of unique DNA-binding and transcriptional-activation functions in the carboxyl-terminal extension of the zinc finger region in the human vitamin D receptor
RL Biochemistry 38:16347-16358 (1999).
RN [3]; RE0015356.
RX PUBMED: 10677485.
RA Yamamoto K., Masuno H., Choi M., Nakashima K., Taga T., Ooizumi H., Umesono K., Sicinska W., VanHooke J., DeLuca H. F., Yamada S.
RT Three-dimensional modeling of and ligand docking to vitamin D receptor ligand binding domain
RL Proc. Natl. Acad. Sci. USA 97:1467-1472 (2000).
RN [4]; RE0016349.
RX PUBMED: 9632111.
RA Hsieh J. C., Shimizu Y., Minoshima S., Shimizu N., Haussler C. A., Jurutka P. W., Haussler M. R.
RT Novel nuclear localization signal between the two DNA-binding zinc fingers in the human vitamin D receptor
RL J. Cell. Biochem. 70:94-109 (1998).
RN [5]; RE0016437.
RX PUBMED: 9632709.
RA Baudino T. A., Kraichely D. M., Jefcoat SC J. r., Winchester S. K., Partridge N. C., MacDonald P. N.
RT Isolation and characterization of a novel coactivator protein, NCoA-62, involved in vitamin D-mediated transcription
RL J. Biol. Chem. 273:16434-16441 (1998).
RN [6]; RE0025974.
RX PUBMED: 9653119.
RA Yuan C. X., Ito M., Fondell J. D., Fu Z. Y., Roeder R. G.
RT The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion
RL Proc. Natl. Acad. Sci. USA 95:7939-44 (1998).
RN [7]; RE0031544.
RX PUBMED: 11250942.
RA Issa L. L., Leong G. M., Barry J. B., Sutherland R. L., Eisman J. A.
RT Glucocorticoid receptor-interacting protein-1 and receptor-associated coactivator-3 differentially interact with the vitamin D receptor (VDR) and regulate VDR-retinoid X receptor transcriptional cross-talk.
RL Endocrinology 142:1606-15 (2001).
RN [8]; RE0034472.
RX PUBMED: 10877839.
RA Polly P., Herdick M., Moehren U., Baniahmad A., Heinzel T., Carlberg C.
RT VDR-Alien: a novel, DNA-selective vitamin D(3) receptor-corepressor partnership.
RL FASEB J. 14:1455-63 (2000).
RN [9]; RE0046545.
RX PUBMED: 11358960.
RA Chan S. W., Hong W.
RT Retinoblastoma-binding protein 2 (Rbp2) potentiates nuclear hormone receptor-mediated transcription
RL J. Biol. Chem. 276:28402-12 (2001).
RN [10]; RE0047400.
RX PUBMED: 15908514.
RA Savkur R. S., Bramlett K. S., Stayrook K. R., Nagpal S., Burris T. P.
RT Coactivation of the human vitamin D receptor by the peroxisome proliferator-activated receptor gamma coactivator-1 alpha.
RL Mol. Pharmacol. 68:511-517 (2005).
RN [11]; RE0047433.
RX PUBMED: 9878542.
RA Tagami T., Lutz W. H., Kumar R., Jameson J. L.
RT The interaction of the vitamin D receptor with nuclear receptor corepressors and coactivators.
RL Biochem. Biophys. Res. Commun. 253:358-363 (1998).
RN [12]; RE0047451.
RX PUBMED: 12460926.
RA Puccetti E., Obradovic D., Beissert T., Bianchini A., Washburn B., Chiaradonna F., Boehrer S., Hoelzer D., Ottmann O. G., Pelicci P. G., Nervi C., Ruthardt M.
RT AML-associated translocation products block vitamin D(3)-induced differentiation by sequestering the vitamin D(3) receptor.
RL Cancer Res. 62:7050-7058 (2002).
RN [13]; RE0047519.
RX PUBMED: 15249124.
RA Nevado J., Tenbaum S. P., Aranda A.
RT hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor.
RL Mol. Cell. Endocrinol. 222:41-51 (2004).
RN [14]; RE0047527.
RX PUBMED: 10866662.
RA Mahajan M. A., Samuels H. H.
RT A new family of nuclear receptor coregulators that integrate nuclear receptor signaling through CREB-binding protein.
RL Mol. Cell. Biol. 20:5048-5063 (2000).
RN [15]; RE0047548.
RX PUBMED: 10733574.
RA Rachez C., Gamble M., Chang C. P., Atkins G. B., Lazar M. A., Freedman L. P.
RT The DRIP complex and SRC-1/p160 coactivators share similar nuclear receptor binding determinants but constitute functionally distinct complexes.
RL Mol. Cell. Biol. 20:2718-2726 (2000).
RN [16]; RE0047552.
RX PUBMED: 16105657.
RA Jian Y., Yan J., Wang H., Chen C., Sun M., Jiang J., Lu J., Yang Y., Gu J.
RT Cyclin D3 interacts with vitamin D receptor and regulates its transcription activity.
RL Biochem. Biophys. Res. Commun. 335:739-748 (2005).
RN [17]; RE0047948.
RX PUBMED: 10383413.
RA Kakizawa T., Miyamoto T., Ichikawa K., Kaneko A., Suzuki S., Hara M., Nagasawa T., Takeda T., Mori J., Kumagai M., Hashizume K.
RT Functional interaction between Oct-1 and retinoid X receptor.
RL J. Biol. Chem. 274:19103-19108 (1999).
RN [18]; RE0051114.
RX PUBMED: 12016314.
RA Makishima M., Lu T. T., Xie W., Whitfield G. K., Domoto H., Evans R. M., Haussler M. R., Mangelsdorf D. J.
RT Vitamin D receptor as an intestinal bile acid sensor.
RL Science 296:1313-1316 (2002).
RN [19]; RE0051190.
RX PUBMED: 16522742.
RA Honjo Y., Sasaki S., Kobayashi Y., Misawa H., Nakamura H.
RT 1,25-dihydroxyvitamin D3 and its receptor inhibit the chenodeoxycholic acid-dependent transactivation by farnesoid X receptor.
RL J. Endocrinol. 188:635-643 (2006).
RN [20]; RE0051298.
RX PUBMED: 10707959.
RA Masuyama H., Hiramatsu Y., Kunitomi M., Kudo T., MacDonald P. N.
RT Endocrine disrupting chemicals, phthalic acid and nonylphenol, activate Pregnane X receptor-mediated transcription.
RL Mol. Endocrinol. 14:421-428 (2000).
RN [21]; RE0051733.
RX PUBMED: 8384219.
RA Jurutka P. W., Hsieh J. C., MacDonald P. N., Terpening C. M., Haussler C. A., Haussler M. R., Whitfield G. K.
RT Phosphorylation of serine 208 in the human vitamin D receptor. The predominant amino acid phosphorylated by casein kinase II, in vitro, and identification as a significant phosphorylation site in intact cells.
RL J. Biol. Chem. 268:6791-6799 (1993).
RN [22]; RE0051780.
RX PUBMED: 9440810.
RA Gill R. K., Atkins L. M., Hollis B. W., Bell N. H.
RT Mapping the domains of the interaction of the vitamin D receptor and steroid receptor coactivator-1.
RL Mol. Endocrinol. 12:57-65 (1998).
RN [23]; RE0051799.
RX PUBMED: 9280066.
RA Masuyama H., Brownfield C. M., St-Arnaud R., MacDonald P. N.
RT Evidence for ligand-dependent intramolecular folding of the AF-2 domain in vitamin D receptor-activated transcription and coactivator interaction.
RL Mol. Endocrinol. 11:1507-1517 (1997).
RN [24]; RE0051801.
RX PUBMED: 9013769.
RA Masuyama H., Jefcoat SC J. r., MacDonald P. N.
RT The N-terminal domain of transcription factor IIB is required for direct interaction with the vitamin D receptor and participates in vitamin D-mediated transcription.
RL Mol. Endocrinol. 11:218-228 (1997).
RN [25]; RE0051855.
RX PUBMED: 10809746.
RA Chen S., Cui J., Nakamura K., Ribeiro R. C., West B. L., Gardner D. G.
RT Coactivator-vitamin D receptor interactions mediate inhibition of the atrial natriuretic peptide promoter.
RL J. Biol. Chem. 275:15039-15048 (2000).
RN [26]; RE0051926.
RX PUBMED: 10068443.
RA Swamy N., Mohr S. C., Xu W., Ray R.
RT Vitamin D receptor interacts with DnaK/heat shock protein 70: identification of DnaK interaction site on vitamin D receptor.
RL Arch. Biochem. Biophys. 363:219-226 (1999).
RN [27]; RE0051939.
RX PUBMED: 9169418.
RA Jurutka P. W., Hsieh J. C., Remus L. S., Whitfield G. K., Thompson P. D., Haussler C. A., Blanco J. C., Ozato K., Haussler M. R.
RT Mutations in the 1,25-dihydroxyvitamin D3 receptor identifying C-terminal amino acids required for transcriptional activation that are functionally dissociated from hormone binding, heterodimeric DNA binding, and interaction with basal transcription factor IIB, in vitro.
RL J. Biol. Chem. 272:14592-14599 (1997).
RN [28]; RE0052028.
RX PUBMED: 10318858.
RA Kraichely D. M., Collins JJ 3. r. d., DeLisle R. K., MacDonald P. N.
RT The autonomous transactivation domain in helix H3 of the vitamin D receptor is required for transactivation and coactivator interaction.
RL J. Biol. Chem. 274:14352-14358 (1999).
RN [29]; RE0053013.
RX PUBMED: 15176999.
RA Kurihara N., Reddy S. V., Araki N., Ishizuka S., Ozono K., Cornish J., Cundy T., Singer F. R., Roodman G. D.
RT Role of TAFII-17, a VDR binding protein, in the increased osteoclast formation in Paget's Disease.
RL J. Bone Miner. Res. 19:1154-1164 (2004).
RN [30]; RE0053029.
RX PUBMED: 12796488.
RA Yamamoto H., Shevde N. K., Warrier A., Plum L. A., DeLuca H. F., Pike J. W.
RT 2-Methylene-19-nor-(20S)-1,25-dihydroxyvitamin D3 potently stimulates gene-specific DNA binding of the vitamin D receptor in osteoblasts.
RL J. Biol. Chem. 278:31756-31765 (2003).
RN [31]; RE0053034.
RX PUBMED: 16059639.
RA Liu Y., Shen Q., Malloy P. J., Soliman E., Peng X., Kim S., Pike J. W., Feldman D., Christakos S.
RT Enhanced coactivator binding and transcriptional activation of mutant vitamin D receptors from patients with hereditary 1,25-dihydroxyvitamin D-resistant rickets by phosphorylation and vitamin D analogs.
RL J. Bone Miner. Res. 20:1680-1691 (2005).
RN [32]; RE0053416.
RX PUBMED: 11514567.
RA Zhang C., Baudino T. A., Dowd D. R., Tokumaru H., Wang W., MacDonald P. N.
RT Ternary complexes and cooperative interplay between NCoA-62/Ski-interacting protein and steroid receptor coactivators in vitamin D receptor-mediated transcription.
RL J. Biol. Chem. 276:40614-40620 (2001).
RN [33]; RE0053453.
RX PUBMED: 9637681.
RA Rachez C., Suldan Z., Ward J., Chang C. P., Burakov D., Erdjument-Bromage H., Tempst P., Freedman L. P.
RT A novel protein complex that interacts with the vitamin D3 receptor in a ligand-dependent manner and enhances VDR transactivation in a cell-free system.
RL Genes Dev. 12:1787-1800 (1998).
RN [34]; RE0053493.
RX PUBMED: 14665442.
RA Barletta F., Dhawan P., Christakos S.
RT Integration of hormone signaling in the regulation of human 25(OH)D3 24-hydroxylase transcription.
RL Am. J. Physiol. Endocrinol. Metab. 286:E598-608 (2004).
RN [35]; RE0053528.
RX PUBMED: 17690094.
RA Yuan W., Pan W., Kong J., Zheng W., Szeto F. L., Wong K. E., Cohen R., Klopot A., Zhang Z., Li Y. C.
RT 1,25-dihydroxyvitamin D3 suppresses renin gene transcription by blocking the activity of the cyclic AMP response element in the renin gene promoter.
RL J. Biol. Chem. 282:29821-29830 (2007).
RN [36]; RE0053569.
RX PUBMED: 16543149.
RA Shah S., Islam M. N., Dakshanamurthy S., Rizvi I., Rao M., Herrell R., Zinser G., Valrance M., Aranda A., Moras D., Norman A., Welsh J., Byers S. W.
RT The molecular basis of vitamin D receptor and beta-catenin crossregulation.
RL Mol. Cell 21:799-809 (2006).
RN [37]; RE0053611.
RX PUBMED: 16936639.
RA Sanchez-Martinez R., Castillo A. I., Steinmeyer A., Aranda A.
RT The retinoid X receptor ligand restores defective signalling by the vitamin D receptor.
RL EMBO Rep. 7:1030-1034 (2006).
RN [38]; RE0053683.
RX PUBMED: 16753019.
RA Nguyen M., d'Alesio A., Pascussi J. M., Kumar R., Griffin M. D., Dong X., Guillozo H., Rizk-Rabin M., Sinding C., Bougneres P., Jehan F., Garabedian M.
RT Vitamin D-resistant rickets and type 1 diabetes in a child with compound heterozygous mutations of the vitamin D receptor (L263R and R391S): dissociated responses of the CYP-24 and rel-B promoters to 1,25-dihydroxyvitamin D3.
RL J. Bone Miner. Res. 21:886-894 (2006).
XX
//