TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08496 XX ID T08496 XX DT 30.01.2006 (created); din. DT 07.09.2011 (updated); mka. CO Copyright (C), QIAGEN. XX FA TFIIB XX SY alpha (rat); CB; CI; FA; factor e; GTF2B; TF2B; TFIIB; transcription initiation factor IIB. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G005158 GTF2B; HGNC: GTF2B. XX CL C0030; histone fold. XX SZ 316 AA; 34.8 kDa (cDNA) (calc.), 33 kDa (SDS) [2] [3], 35 kDa (SDS) [4] [4] [3] [2] XX SQ MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA SQ TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE SQ ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI SQ CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV SQ ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF SQ PTDFKFDTPVDKLPQL XX SC translated from EMBL:M76766 XX FT 1 296 PF00478; IMP dehydrogenase / GMP reductase domain. FT 119 200 SM00385; cyclin_7. FT 121 191 PF00382; Transcription factor TFIIB repeat. FT 213 294 SM00385; cyclin_7. FT 215 285 PF00382; Transcription factor TFIIB repeat. XX IN T01042 HSF1-L; human, Homo sapiens. IN T09196 HSF2A; human, Homo sapiens. IN T09163 OCA-B; human, Homo sapiens. IN T22416 SRC-1 (-Q); human, Homo sapiens. IN T08482 VDR-isoform1; human, Homo sapiens. IN T00885 VDR; human, Homo sapiens. IN T09401 VDR; mouse, Mus musculus. XX MX M01739 V$TFIIB_Q6. MX M08904 V$TFIIB_Q6_02. XX BS R29191. XX DR TRANSPATH: MO000059016. DR EMBL: M76766; DR EMBL: X59268; DR UniProtKB: Q00403; DR PDB: 1TFB. DR PDB: 1VOL. XX RN [1]; RE0005623. RX PUBMED: 8657574. RA Schubart D. B., Sauter P., Massa S., Friedl E. M., Schwarzenbach H., Matthias P. RT Gene structure and characterization of the murine homologue of the B cell-specific transcriptional coactivator OBF-1 RL Nucleic Acids Res. 24:1913-1920 (1996). RN [2]; RE0005680. RX PUBMED: 1876184. RA Ha I., Lane W. S., Reinberg D. RT Cloning of a human gene encoding the general transcription initiation factor IIB RL Nature 352:689-695 (1991). RN [3]; RE0005681. RX PUBMED: 1946368. RA Malik S., Hisatake K., Sumimoto H., Horikoshi M., Roeder R. G. RT Sequence of general transcription factor TFIIB and relationships to other initiation factors RL Proc. Natl. Acad. Sci. USA 88:9553-9557 (1991). RN [4]; RE0005689. RX PUBMED: 1922364. RA Lin Y.-S., Ha I., Maldonado E., Reinberg D., Green M. R. RT Binding of general transcription factor TFIIB to an acidic activating region RL Nature 353:569-571 (1991). RN [5]; RE0006261. RX PUBMED: 7878015. RA Blanco J. C. G., Wang I.-M., Tsai S. Y., Tsai M.-J., O'Malley B. W., Jurutka P. W., Haussler M. R., Ozato K. RT Transcription factor TFIIB and the vitamin D receptor cooperatively activate ligand-dependent transcription RL Proc. Natl. Acad. Sci. USA 92:1535-1539 (1995). RN [6]; RE0031850. RX PUBMED: 11005381. RA Yuan C. X., Gurley W. B. RT Potential targets for HSF1 within the preinitiation complex. RL Cell Stress Chaperones 5:229-42 (2000). RN [7]; RE0047519. RX PUBMED: 15249124. RA Nevado J., Tenbaum S. P., Aranda A. RT hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor. RL Mol. Cell. Endocrinol. 222:41-51 (2004). RN [8]; RE0048228. RX PUBMED: 8754792. RA Takeshita A., Yen P. M., Misiti S., Cardona G. R., Liu Y., Chin W. W. RT Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator. RL Endocrinology 137:3594-3597 (1996). RN [9]; RE0051801. RX PUBMED: 9013769. RA Masuyama H., Jefcoat SC J. r., MacDonald P. N. RT The N-terminal domain of transcription factor IIB is required for direct interaction with the vitamin D receptor and participates in vitamin D-mediated transcription. RL Mol. Endocrinol. 11:218-228 (1997). RN [10]; RE0051939. RX PUBMED: 9169418. RA Jurutka P. W., Hsieh J. C., Remus L. S., Whitfield G. K., Thompson P. D., Haussler C. A., Blanco J. C., Ozato K., Haussler M. R. RT Mutations in the 1,25-dihydroxyvitamin D3 receptor identifying C-terminal amino acids required for transcriptional activation that are functionally dissociated from hormone binding, heterodimeric DNA binding, and interaction with basal transcription factor IIB, in vitro. RL J. Biol. Chem. 272:14592-14599 (1997). RN [11]; RE0051983. RX PUBMED: 12529369. RA Barry J. B., Leong G. M., Church W. B., Issa L. L., Eisman J. A., Gardiner E. M. RT Interactions of SKIP/NCoA-62, TFIIB, and retinoid X receptor with vitamin D receptor helix H10 residues. RL J. Biol. Chem. 278:8224-8228 (2003). XX //