TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09163 XX ID T09163 XX DT 31.07.2006 (created); jul. DT 22.09.2011 (updated); grs. CO Copyright (C), QIAGEN. XX FA OCA-B XX SY B-cell Oct-binding protein 1; Bob1; OBF1; OCA-B; Oct coactivator from B cells; POU2AF1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003984 POU2AF1; HGNC: POU2AF1. XX SZ 256 AA; 27.4 kDa (cDNA) (calc.). XX SQ MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATY SQ TTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSA SQ DMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP SQ QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEE SQ DSDAYALNHTLSVEGF XX SC Swiss-Prot#Q16633 XX FT 1 65 interaction domain [7]. FT 26 32 important for interaction with POU domains [7]. XX IN T00647 Oct-2; human, Homo sapiens. IN T00545 POU2F1; human, Homo sapiens. IN T08520 TBP-isoform1; human, Homo sapiens. IN T08496 TFIIB; human, Homo sapiens. XX MX M02113 V$OCAB_Q6. MX M00795 V$OCT_Q6. XX DR TRANSPATH: MO000083956. DR EMBL: X83504; DR EMBL: Z47550; DR UniProtKB: Q16633; XX RN [1]; RE0000370. RX PUBMED: 2328728. RA Mueller-Immerglueck M. M., Schaffner W., Matthias P. RT Transcription factor Oct-2A contains functionally redundant activating domains and works selectively from a promoter but not from a remote enhancer position in non-lymphoid (HeLa) cells RL EMBO J. 9:1625-1634 (1990). RN [2]; RE0004283. RX PUBMED: 7779176. RA Gstaiger M., Knoepfel L., Georgiev O., Schaffner W., Hovens C. M. RT A B-cell coactivator of octamer-binding transcription factors RL Nature 373:360-362 (1995). RN [3]; RE0004399. RX PUBMED: 1423591. RA Luo Y., Fujii H., Gerster T., Roeder R. G. RT A novel B cell-derived coactivator potentiates the activation of immunoglogulin promoters by octamer-binding transcription RL Cell 71:231-241 (1992). RN [4]; RE0004442. RX PUBMED: 7859290. RA Strubin M., Newell J. W., Matthias P. RT OBF-1, a novel B cell-specific coactivator that stimulates immunoglobulin promoter activity through association with octamer-binding proteins RL Cell 80:497-506 (1995). RN [5]; RE0005623. RX PUBMED: 8657574. RA Schubart D. B., Sauter P., Massa S., Friedl E. M., Schwarzenbach H., Matthias P. RT Gene structure and characterization of the murine homologue of the B cell-specific transcriptional coactivator OBF-1 RL Nucleic Acids Res. 24:1913-1920 (1996). RN [6]; RE0005624. RX PUBMED: 7623806. RA Luo Y., Roeder R. G. RT Cloning, functional charcterization, and mechanism of action of the B-cell-specific transcriptional coactivator OCA-B RL Mol. Cell. Biol. 15:4115-4124 (1995). RN [7]; RE0005625. RX PUBMED: 8654375. RA Gstaiger M., Georgiev O., van Leeuwen H., an der Vliet P., Schaffner W. RT The B cell coactivator Bob1 shows DNA sequence-dependent complex formation with Oct-1/Oct-2 factors, leading to differential promoter activation RL EMBO J. 15:2781-2790 (1996). RN [8]; RE0005626. RX PUBMED: 8769650. RA Cepek K. L., Chasman D. I., Sharp P. A. RT Sequence-specific DNA binding of the B-cell-specific coactivator OCA-B RL Genes Dev. 10:2079-2088 (1996). RN [9]; RE0047947. RX PUBMED: 11134019. RA Kakizawa T., Miyamoto T., Ichikawa K., Takeda T., Suzuki S., Mori J., Kumagai M., Yamashita K., Hashizume K. RT Silencing mediator for retinoid and thyroid hormone receptors interacts with octamer transcription factor-1 and acts as a transcriptional repressor. RL J. Biol. Chem. 276:9720-9725 (2001). RN [10]; RE0066536. RX PUBMED: 16186795. RA Heckman C. A., Duan H., Garcia P. B., Boxer L. M. RT Oct transcription factors mediate t(14;18) lymphoma cell survival by directly regulating bcl-2 expression. RL Oncogene 25:888-898 (2006). XX //