AC T08520
XX
ID T08520
XX
DT 01.02.2006 (created); ili.
CO Copyright (C), QIAGEN.
XX
FA TBP-isoform1
XX
SY TATA-binding protein; TATA-box-binding protein; TBP; TFIID; TFIIDtau.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004647 TBP; HGNC: TBP.
XX
CL C0082; TATA.
XX
SZ 339 AA; 37.7 kDa (cDNA) (calc.), 38-43 kDa (SDS)
XX
SQ MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
SQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQ
SQ LFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDL
SQ KTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
SQ VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
SQ VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT
XX
SC translated from EMBL:M55654
XX
FT 157 273 
essential for TAFII125 contact [3].
FT 202 272 
contact region to PU.1, E1A (basic region) [2].
FT 220 271 
contact region to p53 [1].
FT 273 339 
essential for TAFII250 contact [3].
XX
IN T14184 Cdx-1; mouse, Mus musculus.
IN T01042 HSF1-L; human, Homo sapiens.
IN T09316 NF-YB; mouse, Mus musculus.
IN T19131 NF-YC-isoform1; human, Homo sapiens.
IN T09336 NRL-isoform1; human, Homo sapiens.
IN T09163 OCA-B; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T00630 POU3F2; human, Homo sapiens.
IN T08433 RXR-alpha; human, Homo sapiens.
IN T22416 SRC-1 (-Q); human, Homo sapiens.
IN T02116 TAF2J; human, Homo sapiens.
IN T02206 TAFII250-isoform1; human, Homo sapiens.
IN T00782 TAFII55; human, Homo sapiens.
XX
MX M00252 V$TATA_01.
MX M00216 V$TATA_C.
MX M00471 V$TBP_01.
MX M00980 V$TBP_Q6.
MX M03581 V$TBP_Q6_01.
XX
BS R12021.
BS R39032.
BS R01732.
BS R03165.
BS R10795.
BS R10796.
BS R10797.
BS R10798.
BS R10799.
BS R10800.
BS R10801.
BS R10802.
BS R10803.
BS R10804.
BS R10805.
BS R10806.
BS R10807.
BS R10808.
BS R10809.
BS R10810.
BS R10811.
BS R10812.
BS R10813.
BS R10814.
BS R10815.
BS R10816.
BS R10817.
BS R10818.
BS R10819.
BS R10820.
BS R10821.
BS R10822.
BS R10823.
BS R10824.
BS R10825.
BS R10826.
BS R10827.
BS R10828.
BS R10829.
BS R10830.
BS R10831.
BS R10832.
BS R10833.
BS R10834.
BS R10835.
BS R10836.
BS R10837.
BS R10838.
BS R10839.
BS R10840.
BS R10841.
BS R10842.
BS R10843.
BS R10844.
BS R10845.
BS R10846.
BS R10847.
BS R10848.
BS R10849.
BS R10850.
BS R29463.
BS R01944.
BS R23355.
BS R29191.
BS R14383.
BS R31071.
BS R03171.
BS R11725.
BS R29452.
BS R04010.
BS R23228.
BS R08260.
BS R39026.
BS R08513.
BS R01218.
XX
DR TRANSPATH: MO000059555.
DR EMBL: M55654; HSTFIID.
DR EMBL: X54993; HSTFIIDX.
DR UniProtKB: P20226;
XX
RN [1]; RE0005457.
RX PUBMED: 8497252.
RA Liu X., Miller C. W., Koeffler P. H., Berk A. J.
RT The p53 activation domain binds the TATA box-binding polypeptide in holo-TFIID, and a neighboring p53 domain inhibits transcription
RL Mol. Cell. Biol. 13:3291-3300 (1993).
RN [2]; RE0005546.
RX PUBMED: 1833071.
RA Lee W. S., Kao C. C., Bryant G. O., Liu X., Berk A. J.
RT Adenovirus E1A activation domain binds the basic repeat in the TATA box transcription factor
RL Cell 67:365-376 (1991).
RN [3]; RE0005559.
RX PUBMED: 8436290.
RA Zhou Q., Boyer T. G., Berk A. J.
RT Factors (TAFs) required for activated transcription interact with TATA box-binding protein conserved core domain
RL Genes Dev. 7:180-187 (1993).
RN [4]; RE0005623.
RX PUBMED: 8657574.
RA Schubart D. B., Sauter P., Massa S., Friedl E. M., Schwarzenbach H., Matthias P.
RT Gene structure and characterization of the murine homologue of the B cell-specific transcriptional coactivator OBF-1
RL Nucleic Acids Res. 24:1913-1920 (1996).
RN [5]; RE0010799.
RX PUBMED: 7667283.
RA Schulman I. G., Chakravarti D., Juguilon H., Romo A., Evans R. M.
RT Interactions between the retinoid X receptor and a conserved region of the TATA-binding protein mediate hormone-dependent transactivation
RL Proc. Natl. Acad. Sci. USA 92:8288-8292 (1995).
RN [6]; RE0031850.
RX PUBMED: 11005381.
RA Yuan C. X., Gurley W. B.
RT Potential targets for HSF1 within the preinitiation complex.
RL Cell Stress Chaperones 5:229-42 (2000).
RN [7]; RE0046520.
RX PUBMED: 10567391.
RA Kabe Y., Goto M., Shima D., Imai T., Wada T., Morohashi K., Shirakawa M., Hirose S., Handa H.
RT The role of human MBF1 as a transcriptional coactivator
RL J. Biol. Chem. 274:34196-202 (1999).
RN [8]; RE0047734.
RX PUBMED: 9388200.
RA Leveillard T., Wasylyk B.
RT The MDM2 C-terminal region binds to TAFII250 and is required for MDM2 regulation of the cyclin A promoter.
RL J. Biol. Chem. 272:30651-30661 (1997).
RN [9]; RE0048228.
RX PUBMED: 8754792.
RA Takeshita A., Yen P. M., Misiti S., Cardona G. R., Liu Y., Chin W. W.
RT Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator.
RL Endocrinology 137:3594-3597 (1996).
RN [10]; RE0048249.
RX PUBMED: 9153318.
RA Bellorini M., Lee D. K., Dantonel J. C., Zemzoumi K., Roeder R. G., Tora L., Mantovani R.
RT CCAAT binding NF-Y-TBP interactions: NF-YB and NF-YC require short domains adjacent to their histone fold motifs for association with TBP basic residues.
RL Nucleic Acids Res. 25:2174-2181 (1997).
RN [11]; RE0048326.
RX PUBMED: 15328344.
RA Friedman J. S., Khanna H., Swain P. K., Denicola R., Cheng H., Mitton K. P., Weber C. H., Hicks D., Swaroop A.
RT The minimal transactivation domain of the basic motif-leucine zipper transcription factor NRL interacts with TATA-binding protein.
RL J. Biol. Chem. 279:47233-47241 (2004).
RN [12]; RE0049299.
RX PUBMED: 12379483.
RA Qadri I., Iwahashi M., Simon F.
RT Hepatitis C virus NS5A protein binds TBP and p53, inhibiting their DNA binding and p53 interactions with TBP and ERCC3.
RL Biochim. Biophys. Acta 1592:193-204 (2002).
RN [13]; RE0049459.
RX PUBMED: 15637059.
RA Boyer-Guittaut M., Birsoy K., Potel C., Elliott G., Jaffray E., Desterro J. M., Hay R. T., Oelgeschlager T.
RT SUMO-1 modification of human transcription factor (TF) IID complex subunits: inhibition of TFIID promoter-binding activity through SUMO-1 modification of hsTAF5.
RL J. Biol. Chem. 280:9937-9945 (2005).
RN [14]; RE0051855.
RX PUBMED: 10809746.
RA Chen S., Cui J., Nakamura K., Ribeiro R. C., West B. L., Gardner D. G.
RT Coactivator-vitamin D receptor interactions mediate inhibition of the atrial natriuretic peptide promoter.
RL J. Biol. Chem. 275:15039-15048 (2000).
RN [15]; RE0052321.
RX PUBMED: 17158164.
RA Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund J. N.
RT Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein.
RL Nucleic Acids Res. 35:175-185 (2007).
RN [16]; RE0064992.
RX PUBMED: 11029584.
RA Smit D. J., Smith A. G., Parsons P. G., Muscat G. E., Sturm R. A.
RT Domains of Brn-2 that mediate homodimerization and interaction with general and melanocytic transcription factors.
RL Eur. J. Biochem. 267:6413-6422 (2000).
XX
//