TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T14184 XX ID T14184 XX DT 18.03.2008 (created); grs. DT 03.08.2011 (updated); hna. CO Copyright (C), QIAGEN. XX FA Cdx-1 XX SY caudal type homeo box 1; Cdx; Cdx-1; CDX1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005925 Cdx1. XX CL C0006; homeo; 3.1.1.9.1.1. XX SZ 268 AA; 28.4 kDa (cDNA) (calc.). XX SQ MYVGYVLDKDSPVYPGPARPSSLGLGPPTYAPPGPAPAPPQYPDFAGYTHVEPAPAPPPT SQ WAAPFPAPKDDWAAAYGPGPTASAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGAPG SQ APSSPGAPRRTPYEWMRRSVAAAGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYIT SQ IRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSG SQ PPLGSLCPTNAGLLGTPSPVPVKEEFLP XX SC Swiss-Prot#P18111 XX FT 13 147 PF04731; Caudal like protein activation region. FT 152 212 PS50071; HOMEOBOX_2. FT 154 216 SM00389; HOX_1. FT 155 211 PF00046; Homeobox domain. XX IN T02116 TAF2J; human, Homo sapiens. IN T00782 TAFII55; human, Homo sapiens. IN T08520 TBP-isoform1; human, Homo sapiens. IN T00794 TBP; human, Homo sapiens. XX MX M01373 V$CDX1_01. MX M07377 V$CDX1_Q4. MX M02086 V$CDX1_Q5. MX M07378 V$CDX_Q4. MX M00991 V$CDX_Q5. XX BS R28996. BS R28997. BS R36212. BS R08873. BS R14710. XX DR TRANSPATH: MO000125077. DR EMBL: M37163; DR EMBL: M80463; DR UniProtKB: P18111; XX RN [1]; RE0005006. RX PUBMED: 2905686. RA Duprey P., Chowdhury K., Dressler G. R., Balling R., Simon D., Guenet J. L., Gruss P. RT A mouse gene homologous to the Drosophila gene caudal is expressed in epithelial cells from the embryonic intestine RL Genes Dev. 2:1647-1654 (1988). RN [2]; RE0005007. RX PUBMED: 7903305. RA Hu Y., Kazenwadel J., James R. RT Isolation and characterization of the murine homeo-box gene Cdx-1. Regulation of expression in intestinal epithelial cells RL J. Biol. Chem. 268:27214-27225 (1993). RN [3]; RE0014389. RX PUBMED: 9171078. RA Taylor J. K., Levy T., Suh E. R., Traber P. G. RT Activation of enhancer elements by the homeobox gene Cdx2 is cell line specific RL Nucleic Acids Res. 25:2293-2300 (1997). RN [4]; RE0014407. RX PUBMED: 9428790. RA Taylor J. K., Boll W., Levy T., Suh E., Siang S., Mantei N., Traber P. G. RT Comparison of intestinal phospholipase A/lysophospholipase and sucrase-isomaltase genes suggest a common structure for enterocyte-specific promoters RL DNA Cell Biol. 16:1419-1428 (1997). RN [5]; RE0052321. RX PUBMED: 17158164. RA Calon A., Gross I., Davidson I., Kedinger M., Duluc I., Domon-Dell C., Freund J. N. RT Functional interaction between the homeoprotein CDX1 and the transcriptional machinery containing the TATA-binding protein. RL Nucleic Acids Res. 35:175-185 (2007). XX //