TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09336 XX ID T09336 XX DT 27.09.2006 (created); sri. CO Copyright (C), QIAGEN. XX FA NRL-isoform1 XX SY AS321; D14S46E; neural retina-specific leucine zipper protein; NRL. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003947 NRL; HGNC: NRL. XX CL C0008; bZIP. XX SZ 237 AA; 25.9 kDa (cDNA) (calc.), 30 kDa (SDS) XX SQ MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVG SQ ATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEE SQ TGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKR SQ LQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL XX SC Swiss-Prot#P54845 XX FT 130 224 PF03131; bZIP Maf transcription factor. FT 157 221 SM00338; brlzneu. FT 159 222 PS50217; BZIP. XX IN T08520 TBP-isoform1; human, Homo sapiens. XX BS R28009. BS R28133. BS R36398. XX DR TRANSPATH: MO000087839. DR EMBL: M81840; DR EMBL: M95925; DR UniProtKB: P54845; XX RN [1]; RE0002541. RX PUBMED: 1729696. RA Swaroop A., Xu J., Pawar H., Jackson A., Skolnick C., Agarwal N. RT A conserved retina-specific gene encodes a basic motif/leucine zipper domain RL Proc. Natl. Acad. Sci. USA 89:266-270 (1992). RN [2]; RE0004866. RX PUBMED: 8108109. RA Kerppola T. K., Curran T. RT Maf and Nrl can bind to AP-1 sites and form heterodimers with Fos and Jun RL Oncogene 9:675-684 (1994). RN [3]; RE0012903. RX PUBMED: 8552602. RA Rehemetulla A., Warwar R., Kumar R., Ji X., Zack D. J., Swaroop A. RT The basic motif-leucine zipper transcription factor Nrl can positively regulate rhodopsin gene expression RL Proc. Natl. Acad. Sci. USA 93:191-195 (1996). RN [4]; RE0040140. RX PUBMED: 15001570. RA Pittler S. J., Zhang Y., Chen S., Mears A. J., Zack D. J., Ren Z., Swain P. K., Yao S., Swaroop A., White J. B. RT Functional analysis of the rod photoreceptor cGMP phosphodiesterase alpha-subunit gene promoter: Nrl and Crx are required for full transcriptional activity RL J. Biol. Chem. 279:19800-7 (2004). RN [5]; RE0048326. RX PUBMED: 15328344. RA Friedman J. S., Khanna H., Swain P. K., Denicola R., Cheng H., Mitton K. P., Weber C. H., Hicks D., Swaroop A. RT The minimal transactivation domain of the basic motif-leucine zipper transcription factor NRL interacts with TATA-binding protein. RL J. Biol. Chem. 279:47233-47241 (2004). RN [6]; RE0067852. RX PUBMED: 20551322. RA Roger J. E., Nellissery J., Kim D. S., Swaroop A. RT Sumoylation of bZIP transcription factor NRL modulates target gene expression during photoreceptor differentiation. RL J. Biol. Chem. 285:25637-25644 (2010). XX //