TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09316 XX ID T09316 XX DT 13.09.2006 (created); sri. DT 17.01.2012 (updated); jtr. CO Copyright (C), QIAGEN. XX FA NF-YB XX SY CBF-A (rat); CP1a (human, rat); HAP3 (yeast); NF-YB; NFYB, CBF-A. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004108 Nfyb. XX CL C0030; histone fold. XX SZ 207 AA; 22.8 kDa (cDNA) (calc.), 32 kDa (SDS) XX SQ MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP SQ IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF SQ AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVSATDGLSEELTEEAFTNQLPAGLIT SQ ADGQQQNVMVYTTSYQQISGVQQIQFS XX SC Swiss-Prot#P63139 XX FT 57 122 PF00808; Histone-like transcription factor (CBF/. FT 61 125 predicted histone fold triple helix [4]. FT 61 125 PS50028; HIST_TAF. XX IN T08520 TBP-isoform1; human, Homo sapiens. XX MX M00209 V$NFY_C. MX M07302 V$NFY_Q3. MX M00185 V$NFY_Q6. MX M00775 V$NFY_Q6_01. XX BS R37753. BS R37754. BS R17073. XX DR TRANSPATH: MO000087237. DR EMBL: A20553; DR EMBL: M55045; DR EMBL: X55316; DR UniProtKB: P63139; XX RN [1]; RE0000447. RX PUBMED: 1698608. RA Hooft van Huijsduijnen R., Li X. Y., Black D., Matthes H., Benoist C., Mathis D. RT Co-evolution from yeast to mouse: cDNA cloning of the two NF-Y (CP-1/CBF) subunits RL EMBO J. 9:3119-3127 (1990). RN [2]; RE0002858. RX PUBMED: 1644837. RA Maity S. N., Sinha S., Ruteshouser E. C., de Crombrugghe B. RT Three different polypeptides are necessary for DNA binding of the mammalian heteromeric CCAAT binding factor RL J. Biol. Chem. 267:16574-16580 (1992). RN [3]; RE0003045. RX PUBMED: 1577736. RA Li X. Y., Hooft van Huijsduijnen R., Mantovani R., Benoist C., Mathis D. RT Intro-exon organization of the NF-Y genes. Tissue-specific splicing modifies an activation domain RL J. Biol. Chem. 267:8984-8990 (1992). RN [4]; RE0017971. RX PUBMED: 9662544. RA Edwards D., Murray J. A., Smith A. G. RT Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. RL Plant Physiol. 117:1015-1022 (1998). RN [5]; RE0022625. RX PUBMED: 7509302. RA Sohn K. Y., Maity S. N., de Crombrugghe B. RT Studies on the structure of the mouse CBF-A gene and properties of a truncated CBF-A isoform generated from an alternatively spliced RNA. RL Gene 139:147-153 (1994). XX //